SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009519 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009519
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000288
Family F-box domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009519   Gene: ENSOARG00000008868   Transcript: ENSOART00000009656
Sequence length 326
Comment pep:known_by_projection chromosome:Oar_v3.1:16:32528500:32540454:-1 gene:ENSOARG00000008868 transcript:ENSOART00000009656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQIDVQLYILSFLSPHDLCQLGSTSHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDL
EILKKPISEVTNGAFFDYMAVYKMCCPHTRRSSKSSRPMYGAVTSFLHSLIIQNEPRFAM
FGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVSFQLNNQHKFNILILYSTTR
KERDRAREEHTSAVNKMFNIQNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKRH
EWQDEFSRIMAMTDPAFGSSGRPMLVLSCISQANVKRMPCFYLAHELRLNHLNYPWMVQD
TEAETLTGFLNGIQWILEEVESKHAR
Download sequence
Identical sequences W5PGF3
ENSOARP00000009519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]