SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009539 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009539
Domain Number 1 Region: 13-63
Classification Level Classification E-value
Superfamily F-box domain 0.0000048
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009539   Gene: ENSOARG00000008884   Transcript: ENSOART00000009676
Sequence length 179
Comment pep:novel chromosome:Oar_v3.1:13:45602:52023:-1 gene:ENSOARG00000008884 transcript:ENSOART00000009676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KWTCKLNSFLTLFFQVSWHWKNLTELDQLWMLKCLRFNWYINVSPTAYEQGVWKKHYIQM
VKELHVTKPKTPPKDGFVITDVQPIRSSSPGGKLSSSSAFRSSSSLRKKNHPGEKELPPW
RSSDKHPTDIIRFNYLDNRDPIEHSWQGRRKTHEMTPAFNQGSHDKKNKSQDRSKLRKA
Download sequence
Identical sequences W5PGH3
ENSOARP00000009539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]