SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009556 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009556
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-40
Family Frizzled cysteine-rich domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily TIMP-like 6.47e-18
Family Netrin-like domain (NTR/C345C module) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009556   Gene: ENSOARG00000008899   Transcript: ENSOART00000009693
Sequence length 346
Comment pep:known_by_projection chromosome:Oar_v3.1:4:49723506:49732978:-1 gene:ENSOARG00000008899 transcript:ENSOART00000009693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSILTALCLWLRLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPDDVKWIDITPDMMVQERPLDIDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSVQWEERLQEQQRTTQD
KKRTAGRTSRSNAPKPKGKPPAPKPASPKKNIKARSAPKSTNPKRA
Download sequence
Identical sequences W5PGJ0
ENSOARP00000009556 XP_004007916.1.66739 XP_005961082.1.78601 XP_012005713.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]