SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009589 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009589
Domain Number 1 Region: 1079-1246
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-43
Family C-type lectin domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 168-284
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-39
Family Link domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1247-1307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1043-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 61-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000118
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009589   Gene: ENSOARG00000008924   Transcript: ENSOART00000009727
Sequence length 1355
Comment pep:known_by_projection chromosome:Oar_v3.1:5:3785638:3817629:-1 gene:ENSOARG00000008924 transcript:ENSOART00000009727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPRDALELGARSRMGALPVWVSGLLTLQMLLFVAGEQVRPSSPPFPPQARSTPLHMQKV
GSRSVRAALAELVALPCLFSLRPRPGATREAPRIKWTKVRTASGQRQDLPILVAKDNVVR
VAKGWQGRVSLPAYPRHRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVF
HYRAALDRYSLTFAEAQEACRLNSATIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQ
SRPGCYGDRSSLPGVRNYGRRDPRELYDVYCFARELGGEVFYVGLARRLTLAGARWPRPK
GVRFANGHAPTSGWKVSCLEPCTGAPAGKGTRLATPPRQGHGPRDRTRGWPSPLVTGIPE
TTQRVRGAQRDRTHHPTSQHGDPETPSSGDEGEILSAEGPPAGELEPSLQEEEVVAPDVQ
EPLVSSGEEESLILAEKQESQATPSRAPGVPTLASSPALEAEEVWLSTVAPSHSSVEAGT
VVGTHTDTAPASTTPRKRERFKGLNGRHFQQQEPQQGLKGALEASIQPPTPEAAGNYVEP
PMTTGATDALGSGQSQSPWAVLTNEVEMPRAGSLGGRSPQEPWLWPPTVVPPIIPDPSRA
LGLELEEAKHFSMRPVTSELPWSPSETTPNPSSGPSPAPWEASPALISPDLPVAAMLRAP
KLWLLSQAPPTPLPTEALATALPSSASEIEASPQDPIHPEVYSLPSSSGLAGQDRGSTSL
SAATDTQAGASPSSPGTDFGNTRGASPTELSKAEHPGSSPQASVDGSVVADVIISETATE
PMGAGGVSESEPGVLNTAESPTSSLQASIVKTQGIWASLHREGLDPHSPSAPLGVPEVSL
MPKVTPRLGPWAATEGGVTVDPMDPTVTLGTSDAGGHWEPGSHMVEGAESPTLSPQMAVD
ASVVTPLTSLDLGDKVGVLAVFTVASSSSQPHPEPKGQLVTQGTLGALEPPQEGSRSGDP
ILPPWTPTAANKDEPISVSSGEPTVPWDSPSTLLPASLGPEEFELEVLMGSPGVESFWEE
AASGEEPALPGTPANGSAEEVPLDPCENNPCLHGGTCRANGTVYGCSCDQGFAGENCEID
IDDCISSPCENGGTCIDEVNAFICLCLPSYGGSLCEKDTEGCDHGWHKFLGHCYRYFAHR
RAWEDAERDCRRRAGHLTSIHSPEEHNFINSFGRENTWIGLNDRIVERDFQWTDNTGLQF
ENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCNYNLPYVCKKGTVLCGPPPAVENASP
IGARKAKYNVHATVRYQCDEGFAQHHVAVIRCRSNGKWDRPQIVCTKPRRSHRMRRHHHH
HQHHHQHRHHKSRKERRKHKKHPAEDWEKEEGNFC
Download sequence
Identical sequences W5PGM3
ENSOARP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]