SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009642 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009642
Domain Number 1 Region: 236-434
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.51e-48
Family Reprolysin-like 0.00022
Further Details:      
 
Domain Number 2 Region: 458-527
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000000236
Family Blood coagulation inhibitor (disintegrin) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000009642
Domain Number - Region: 682-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009642   Gene: ENSOARG00000008974   Transcript: ENSOART00000009781
Sequence length 772
Comment pep:known_by_projection chromosome:Oar_v3.1:11:43908195:43925528:1 gene:ENSOARG00000008974 transcript:ENSOART00000009781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRWASVCSHGLLSPGVGTGGPAGALRWRVSPHLGGPEAPEVTEPSRLVGESSGGEVRKQQ
LDTRVRQEPPGGPPVHLAQVSFVIPAFNSNFTLDLELNHHLLSSQYVERHFSREGPTQHS
TGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNFTYIVEPREMAGPRENAQGPLPH
LIYRTPLLIFSLPGPAGTLPPGCLFAAPDHPAPPNRPRLRRKRQVRRGHPTVHSETKYVE
LIVINDHQLFGQMRQSVVLTSNFAKSVVNLADVMYKEQLNTRIVLVAMETWADGDKIQVQ
DDLLETLARLMVYRREGLPEASDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEYDN
MGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDNWLGCIMEDTGFYLPRKFSRCSIDEY
NQFLQEGGGSCLFNKPLKLLDPPECGGGGRGGGCEGGSGVPQECSRAGGNCCKKCTLTHD
AMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRC
YGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCNKQDVLCGFLL
CVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCL
DHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTG
ETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRYDPTQQGAV
Download sequence
Identical sequences W5PGS6
ENSOARP00000009642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]