SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009686 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009686
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-38
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 7.28e-37
Family Link domain 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009686   Gene: ENSOARG00000009019   Transcript: ENSOART00000009826
Sequence length 280
Comment pep:known_by_projection chromosome:Oar_v3.1:2:156952865:156971348:-1 gene:ENSOARG00000009019 transcript:ENSOART00000009826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFVLLWEEAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYAEAKAVCEY
EGGSLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYDDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPACLADYVEVYDSYDDVHGFVGRYCGDDLPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVTVDPLSKSTQGKNASTTSTTSAGNKNFLAGRFSHL
Download sequence
Identical sequences W5PGW9
XP_004004753.1.66739 XP_012005208.1.54773 ENSOARP00000009686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]