SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009719 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009719
Domain Number 1 Region: 44-186
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.62e-27
Family Calcium ATPase, transmembrane domain M 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000009719
Domain Number - Region: 188-219
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.000275
Family Calcium ATPase, transduction domain A 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009719   Gene: ENSOARG00000009057   Transcript: ENSOART00000009861
Sequence length 245
Comment pep:novel chromosome:Oar_v3.1:12:5621883:5636170:1 gene:ENSOARG00000009057 transcript:ENSOART00000009861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNPTEHTLPANSILESREGEFGCTVMDLRKLMELRSSDAVDQINIHYGGVTSLCSRLQT
NPVEGLSGNPADLEKRKQVFGQNLIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPPGGENEQCGLAVSSPEDEGEAEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QNRIEKEQKFSVIRNGHIIQLPVAEIVVGDIAQIKYGESSVVLFSSSSVSYTSDTLPNRG
LGPLA
Download sequence
Identical sequences W5PH02
ENSOARP00000009719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]