SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010058 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010058
Domain Number 1 Region: 313-412,479-498,571-667
Classification Level Classification E-value
Superfamily RNI-like 2.09e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 2 Region: 187-279
Classification Level Classification E-value
Superfamily F-box domain 2.88e-19
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010058   Gene: ENSOARG00000009374   Transcript: ENSOART00000010204
Sequence length 678
Comment pep:known_by_projection chromosome:Oar_v3.1:6:110345836:110400158:-1 gene:ENSOARG00000009374 transcript:ENSOART00000010204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCDRRYTHRSLAQLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRS
QTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEV
FQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEERQKFFKYSVDEKSD
KEAEVSEQSTGISHLPPEVMVSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHW
ARGDWYSGPATELDTEPDEEWVKNRQDESRAFQEWDEDADIDESEESGEESIAISIAQME
KRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISDSAF
DSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTTHESGLLKTSTSKDTSTTWKN
KDITMQSFKQSACLHDVTNKDIGEEVDNEHPWTKPISSDDFTSPYVWMLDAEDLADIEDA
VEWRHRNVESLCVMETASNFSCPSSACYSKDIVGLRTSVCWQQHCASPAFAYCGHSYCCT
GTALRTMSALPESSALCRKAPRTRLLREKDLIYSGSEKSDQETGRVLLFLSLSGCYQITD
HGLRVLTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNINGPHADTA
SGCQNLQCGFRACCRSGE
Download sequence
Identical sequences W5PHZ0
ENSOARP00000010058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]