SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010075 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010075
Domain Number 1 Region: 342-392
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010075   Gene: ENSOARG00000009388   Transcript: ENSOART00000010221
Sequence length 826
Comment pep:known_by_projection chromosome:Oar_v3.1:10:21906715:21935955:1 gene:ENSOARG00000009388 transcript:ENSOART00000010221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQMLKDFSNLLLVVLCDYVLGEAEYLVLGEPGHVALSNSTVTVDFHGANGTLRNVSVLL
VEASSNQTLTTKYLLTNQSQGTLEFECFYFKEAGDYWFMMTREATNSSLPVPSRERSAFL
KVEWPVFHVDLSRTSKAAEGTFQVGLFTSQPLCPFPGDKPNILLEVTFTNSLPEARANQA
LPLEIRASKRVALAQGQWVEFDCPPVGPEAYITVTVVLKLLGRDSVIMSTGPIDLAQKFG
YKLVMEPELTCEAGVEVTVLPPPCIFVQGVITVFKEAPRLPGERTNRLAENSLALGERRT
VFNCTLFDMGRNKYCFDFGVSSRSQFSAKEKECMLIRRSIETWGLWQPWSQCSASCGDGV
RERRRVCLTSSPSRPGCPGMSSETSPCSLEDCAVAFQPSSPSPLQPQAPVKSNNVVTVTG
ISLCLFIIVATVLITLWRKLGRAPKCSTPARHNSLHGPGCRKNSDEENICELSEPRGSFS
DVGDGPAGSPGDPGIPLTYRRSVPAPPDDEASGSESFQANAQKIIPPLFSYRLAQQQLKE
MKKKGLTETTKVYHVSQSPLTDTAIDAAAAAAAAAASPGGPESPEEATAGKFRIKSPFLE
QPPAVGAGDRPPSRLDHPLSAASCXRTASFHEARQARPFRERSLSTLTPRPTPAHGPRAR
TWDQAGERGRPPSRGAALFPEKRDHGPGAAGASGPLSPLPKPHSLGPPPRKPDLGDRQAG
FVGAGERPEPPRARRGPSPSHRSVSRKQPSPPAPKDGYQRVSPLSPSQGRKDKCQSFPAH
PEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDETTSTLSVEKLVI
Download sequence
Identical sequences W5PI07
ENSOARP00000010075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]