SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010156 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010156
Domain Number 1 Region: 1056-1185
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000399
Family GAF domain 0.023
Further Details:      
 
Domain Number 2 Region: 295-352,892-938
Classification Level Classification E-value
Superfamily EF-hand 0.00000288
Family Calbindin D9K 0.078
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000010156
Domain Number - Region: 382-455,894-971
Classification Level Classification E-value
Superfamily EF-hand 0.000795
Family Calbindin D9K 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010156   Gene: ENSOARG00000009452   Transcript: ENSOART00000010304
Sequence length 1526
Comment pep:known_by_projection chromosome:Oar_v3.1:11:20769784:20856633:1 gene:ENSOARG00000009452 transcript:ENSOART00000010304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESAPQEEPAQENGKEDKERNQGGSEAEELIQSSQSISDSSALGTCNNVTGAEANKKSQ
DLNLENQPKISACSIKESKTRVSKNIVFRKPAKVIFNLDQTPQDSNWEQPWKKNLLERVQ
ARAQAMHQKIIDKENLKKELEKKAEEKLPRDNLAKEWFNTENMTLSTRAYLLDKLLPTLV
PGMERMLMQVEKKKLLADVDIPTKFDPINHLGEYLMRNNPNYIKDPGLSGYQRVMKDISE
DLKIHVPNTTYNRVSKIKENIKQKREQKEYINDIKAKVANARKQALQEQFNEWILDPKGM
IPMVVIQNVLYEFFQNPDLQLELETCCLPADIADSMKPRLNKTEFIQLISFHIAGFKSET
FEKLLKHLCHCADEFREVIKTDMRRQMFAELFLHCDRGKVGFLDRQRTLALLETFYDRSS
KVLKGILRNPRQWPFVEFGEIDLPEFWGDMDNQKHIYEDFDNVLLEMNTLPSEKHFSKTQ
SKLLASPEDQHEHYRESTLPQSPPEQQRGATVEQGPNGISTREQEQPEESTGEQELNEES
VSKEGTYTGSTREQRSSRELITEQRPHHEPITEQGVPQGTHIESTAKQGLSEESVTTEGQ
HERSTTGQGSHGKSTEEQGSRRESQSDLEQPRESTAEQEAGRASQSDQGQPRETMAGQEE
HRESQSDQGPRRGSTAEPQSPREAIREEQQDTDLPSRSRKGSIIGESKTSRESVSFEHTE
IPPQEERTQVQPYEQLLFISPELQEKIGVSSPKDHLSEPAKKEVQKDKSCEPKSQKIEGK
SWTGELLTCNWSMKYAKHEDEEQANLIYDNPRFADLHSIIRNIQSYKEIKGRSAFNGVSF
NLLQFVQLLETFVGEDSPLSVSEALISFFKKGFVETKEEKMSGLEKARQNASQIRRELLL
KALFQKWDSDGSGFLDLKEIDELLYTYKEGMEKESMKKAKLHVQFPKLHPGHEVRLSSKQ
FQKYIELVVSELRGNEEEVLESVVEFLMNSLERSHVESLRNCARQKWLHQIQRAAETSGV
SLEPVYTETFKALTQDAEAHGNKKISAHISLLEENILLPDRGNVLLRNVACTLDDAPFVL
KRVLYRDMKGISFTVVDEGKPIHVPQVQHHGNIYFWNHSRKKSDHNGSFLALPLQDAYMR
ISGVLAVDTLRDPQKINIFLPHEIRFYQGVANAFSAAYHYVHSREHILHIVITGIGWLYS
ITPSITAISTYFVEPNSEKDSDYVLRNMMVTGQQGLTEIHKNPSVVFRKTCIFRDFLFKC
TDSSEVVLASICGENHIVVPLRERTGEALGVLDVNIGKSKMLLYREFKDLQKMLKVIQLA
CSEILGELSGEIKKNCILEIESVGEVQRAGVLFFRVMLQELQECLGLLTSSDFVSLLLYD
YDSLAVGKADSQSPDVKANIKLVQDILKGIIVFFHPELKSSDLESWDYCKLYVNQQLVEN
ICDFDPTAMELKVNLKLIVEYFEDHSRIEVWKLGNSAIEYLYHWAHICLALIKLNKKISS
AISPPLPSKTDSYVYAKMPGGSLPGK
Download sequence
Identical sequences W5PI88
ENSOARP00000010156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]