SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010165 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010165
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000141
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 102-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000429
Family Fibronectin type I module 0.092
Further Details:      
 
Domain Number 3 Region: 207-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010165   Gene: ENSOARG00000009469   Transcript: ENSOART00000010313
Sequence length 346
Comment pep:known_by_projection chromosome:Oar_v3.1:9:57701139:57708761:-1 gene:ENSOARG00000009469 transcript:ENSOART00000010313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGAQSPSLGLPKQCLCLAFLLLRLLGQVAAAERCPSSCPAACPPEPPTCAPGVRAVLDD
CSCCLVCARQRGETCSVLLPCEESRGLFCDRRADPSAQTGICMAVEGDNCVFDGVIYQSG
ETFQPSCKYQCACQDGQVGCVPRCEEDLLLPQPDCPAPRKVKVPGECCEKWICDTKETGT
LGGLQTLPAYRPEATLGVAVSDSSVNCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVK
QTRLCMVRPCDQEHRQPTDKKGKKCLRSIKSLKAIHLQFENCTSLHTYKPRFCGICSDGR
CCTPHNTKTIQVEFQCSPGQILKKPVMVIGTCTCHNNCPHSNSSFL
Download sequence
Identical sequences W5PI97
ENSOARP00000010165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]