SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010207 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010207
Domain Number 1 Region: 101-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 39-87
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 3 Region: 508-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000617
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010207   Gene: ENSOARG00000009510   Transcript: ENSOART00000010356
Sequence length 548
Comment pep:known_by_projection chromosome:Oar_v3.1:16:35014734:35075088:1 gene:ENSOARG00000009510 transcript:ENSOART00000010356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGQRFAFAICLLEISLLRAGPTPSYNPEERHGTPLPIDCRMSSWSEWSKCDPCLKQMF
RSRSIEIFGQFNGRRCVDAVGDRRQCVPTEACEDPEDDCGNNFQCGTGRCIKNQLLCNDD
NDCGDYSDEDNCERDPRPPCRNRVVEESELARTAGYGINILGMDPLSTPFDNQYYNGLCD
RVRDGNTLTYYRKPWNVASLSYDTKVDKNFRTENHEEEIQVLRTIIEEKKLNVNADLTIK
YTPVEAIEKHKCTDLEHSDQKNVSSPSKLAAEATFRFTYSKEDIYRLLSSYSAKKEKAFL
HVKGKVHLGRFVMRSRDVMLQTTFLDSINALPTAYEKGEYFAFLETYGTHYSSSGSLGGL
YELIYVLDKKSMEQKGIEVRDVQRCLGFDLDLSLKAGVEVTGNVDSKLCSKKGMGQMDAK
PEADLFDDVITFIRGGTRKYATELKEKLLRGAKTINVTDFVNWASSLNDAPVLISQKLAP
IYDLIPVKMKDAHLKKQNLERAIEDYINEFSSRKCEPCQNGGTVVLLDGECVCSCLKEFK
GVACEIKK
Download sequence
Identical sequences W5PID9
XP_004017075.2.66739 ENSOARP00000010207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]