SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010279 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010279
Domain Number 1 Region: 497-527,565-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000159
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010279   Gene: ENSOARG00000009573   Transcript: ENSOART00000010431
Sequence length 655
Comment pep:known_by_projection chromosome:Oar_v3.1:9:85659346:85807915:-1 gene:ENSOARG00000009573 transcript:ENSOART00000010431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSMPWSKMRMPRCEDFKLWCRRRLPILEWATHYSLKESLLPDTVSGMMLAVQ
QVAQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
LSSQNLTTRSNTSVLGLSDFEMQRISVAAAVSFLGGVIQVAMFVLQLGSATFLITEPVVS
AMTTGAATHVVTSQAKYLLGMKMPHISGPLGFFYIYAYIFKNIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKIVLPVDLVLMIATSLTCYCTNMENTYGLEVVGHIPKGIPPPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFRYSVDDNQEFLAHGLSNVIASFFFCI
PSAAAIGRTAGLYSTGAKTQVACLISCIFVLIVIYTIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKRYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVVCTTAIVIGRFPRANTLST
KNMKEMEFKVKTEMDDETLQRVKIISINNPLVFLNAKKFYNDIMNIIQKENTGNQPHDEI
RKYEQSTLVSSLSGICNEEATQPCLNPKCSLILDCSGLTFSDYTGVSMLIEVYMDCKNKS
VDVCLVHCTASLVKAMKYCGNLDSEKPIFFESVSAAISNMHLNKNLSILSDHSEI
Download sequence
Identical sequences W5PIL0
XP_004011892.1.66739 XP_012039544.1.66739 XP_012039545.1.66739 XP_014953418.1.66739 XP_014953419.1.66739 XP_014953420.1.66739 XP_014953421.1.66739 ENSOARP00000010279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]