SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010298 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010298
Domain Number 1 Region: 234-474
Classification Level Classification E-value
Superfamily RNI-like 2.8e-43
Family 28-residue LRR 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000010298
Domain Number - Region: 124-160
Classification Level Classification E-value
Superfamily F-box domain 0.000168
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010298   Gene: ENSOARG00000009601   Transcript: ENSOART00000010451
Sequence length 502
Comment pep:known_by_projection chromosome:Oar_v3.1:20:17859241:17865949:-1 gene:ENSOARG00000009601 transcript:ENSOART00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQETQTIESPSIPSRSSTSTQDRSSTVGQTSSTAPQPSKPTPIIPPLAKSTGPGSGSVVR
RMRRIIAEDAEWSLAIVPLLTELCIQHIVKNFQNNPILKQLLPEHQKKVLNHLSPDLPLA
VTANLIDDESYWRRCCMQRWPVCHVDNHGGSWKRMFFELHLANLLKHFIPNTTDPAVILN
LLPLCRNYVRVLRVDQFLPPVQLPAPPRSGDQSDSGSEGEMEEPAMDHYQLDNLVAGLSH
LEELDLVYGVKDCGMNFEWNLFLFTYRDCHSLAATVKACHTLKIFRLTRSKVDDDKARIL
IRSLLDHPALEELDLSHNLIGDRGARAAAKLLSHSRLRVLNLANNQVRAPGAHSLAHALG
HNSNLISLNLRLNCIEDEGGQALAHALHTNKCLTTLHLGGNELSEPTATLLSQVLTINTT
LTSINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDIAQESEYLIGQALCANREAARQ
RALNPSHLMSPVTAKGPENPVG
Download sequence
Identical sequences W5PIM9
ENSOARP00000010298 XP_004018906.1.66739 XP_011956138.1.66739 XP_011969412.1.54773 XP_011969413.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]