SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010306 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010306
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000178
Family BAR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010306   Gene: ENSOARG00000009611   Transcript: ENSOART00000010459
Sequence length 255
Comment pep:known_by_projection scaffold:Oar_v3.1:JH922057.1:1918:13641:-1 gene:ENSOARG00000009611 transcript:ENSOART00000010459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNT
FTVKAQPRKKTKLFSRLRRKKNSDSAPAKGNKSPSPPPDGSPAATPEIRVNHEPEPAGAA
TPGAALPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFDDTFVPEISVTTPSQVSRGH
RGPALHLLLLFRGVHGLPLHPMPCASASEARRPTAGIGSEPPSRTSAHSPAHHSSFLSEH
VANGGTWANDPYRDG
Download sequence
Identical sequences W5PIN7
ENSOARP00000010306 XP_011963330.2.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]