SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010389 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010389
Domain Number 1 Region: 252-462
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.78e-51
Family Reprolysin-like 0.0031
Further Details:      
 
Domain Number 2 Region: 553-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000111
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010389   Gene: ENSOARG00000009686   Transcript: ENSOART00000010544
Sequence length 851
Comment pep:known_by_projection chromosome:Oar_v3.1:1:110732480:110743111:-1 gene:ENSOARG00000009686 transcript:ENSOART00000010544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSPQTAKRSFSKPGQGGLGAQMASVPPSCSISAMSQMDSHPGRGLADGWLWGIQPRLL
LPTVPLSISRLVWLLLLASLLPSAWLASPLPREEEIVFPEKLNGSVLPGLGAPARLLYRL
PAFGETLLLELEKDPGLQVEGLTVQYLGRAPELLGGAEPGTYLTGTINGDPESVASLHWD
GGALLGVLQYRGTELHIQPLEGGAPNSAGGPGAHILRRKSPVSGQGPMCNVKAPPGKPSP
SPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLV
VTRLVVLGPGEEGPQVGPSAAQTLRSFCAWQRGLNTPDDADPDHFDTAILFTRQDLCGVS
TCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELGHVFSMLHDSSKQCAGLNGPES
TSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCLLDKPEAPLHLPMTFPGKDYDA
DRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGR
CLHVDQLQAFNVPQAGGWGPWGSWGDCSRSCGGGVQFSYRDCTRPVPRNGGKYCEGRRTR
FRSCNTQDCPTGSALTFREEQCAAYNHRTDLFKNFPGPMDWVPRYTGVAPRDQCKLTCQT
RALGYYYVLDPRVADGTPCSPDSSSVCVQGRCIHAGCDRVIGSKKKFDKCMVCGGDGSSC
SKQSGSFKKFRYGYNNVVTIPAGATHILVRQQGSPGVRSLYLALKLPDGSYALNGEYTLI
PSPKDVVLPGAVSLRYSGATAAVETLSGHGPLAEPLTLQVLVAGNPQNARLRYSFFVPRP
APSPPRPPGRK
Download sequence
Identical sequences W5PIW9
ENSOARP00000010389 XP_004003769.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]