SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010422 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010422
Domain Number 1 Region: 148-464
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.01e-121
Family Transglutaminase core 0.0000000111
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily E set domains 8.75e-44
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.32e-25
Family Transglutaminase, two C-terminal domains 0.00064
Further Details:      
 
Domain Number 4 Region: 488-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.4e-24
Family Transglutaminase, two C-terminal domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010422   Gene: ENSOARG00000009715   Transcript: ENSOART00000010577
Sequence length 710
Comment pep:known_by_projection chromosome:Oar_v3.1:18:53988800:54001653:-1 gene:ENSOARG00000009715 transcript:ENSOART00000010577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPPVAALELRSVDLQSAKNNQEHHTQEMGLQRLIVRRSQSFTIQLHFNRPFHSKNDSITF
VAETGPAPKELLGTRATFLLTQARQGNGWSASDFTVHANSLYVSLFTPPSAVIGPYSLKM
EISQGPSHSTTHPLGTFILLFNPWSAEDDVYLPSETLLQEYIMMDYGFVYKGHERFITPW
PWNYGQFEEDIIDICFEILNKSLYFLKNPSKDYSQRNDVVYICRVVSAMINSNDDSGVLQ
GNWGEDYSRGVSPLEWTGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVV
SNFRSAHNSDANLTIDTYYDQHAEMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFRCGPASVKAIREGEIHLPYDTPFVYAEVNADEVVWLLKDGQAQEILAH
NTSSIGKEISTKMVGSDQRENITSSYKYPEGSPEERSVFMKASQKTLGVRRTSSPFLDLL
GSGGAVGQPAQLQLHLTRKPEWGQDLLLKLHARRVADRAHPQGPIHLVVDFCAQTLLHNG
GTRKPLWRQKVHLTLDFGEDIQWPLSLPYNNYRNKLTDEKLIRVSGIAKVEETGRSMLVL
KDISLEPPHLSIEVSERAEVGKALRVHISLTNTLSVPLSHCTMVLEGSGLVSGQISNDLG
TLVAGHTIKIQVDLYPIKAGPRQLQVLVSSNEIKEIKGYKDIFVAAARAP
Download sequence
Identical sequences W5PJ02
ENSOARP00000010422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]