SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010480 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010480
Domain Number 1 Region: 37-282
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.2e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 283-472
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.66e-36
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00033
Further Details:      
 
Domain Number 3 Region: 617-787
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-27
Family AlaX-like 0.029
Further Details:      
 
Domain Number 4 Region: 544-612
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000812
Family AlaX-M N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010480   Gene: ENSOARG00000009761   Transcript: ENSOART00000010635
Sequence length 974
Comment pep:known_by_projection chromosome:Oar_v3.1:20:17878009:17889810:-1 gene:ENSOARG00000009761 transcript:ENSOART00000010635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAAVPAAAGRLRRAIRRSPSWRGLRALSSEAPPTQAAAVRDAFLNFFRDRHGHRLVPSA
SVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHSDLEDVG
RDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFGGDPKAGLGP
DLESRDVWLNLGVPASRVLSFGPEENFWEMGDTGPCGPCTEIHYDLAGGAGAPQLVELWN
LVFMQHNREADGSLQPLPQRHVDTGMGLERLVAVLQGRLSTYDTDLFSPLLDAIHQGCGA
PPYSGRVGAADEGRIDTAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRFST
EVLQAPSGFLGSLVPVVVETLGDAYPELRRSSAQVLDSGGRDSQPGVGRRVIERTLKRLG
PSDVFPAEVAWSLSLSGNLGLPLDLVELMLEEKGVQLDTAGLERLAPEEAQHRALQAEPV
QEQGLRLNVHALGELQRRGVPPTDDSPKYSYSLRPGGGYEFSTCEAQVLQLYTEDGTAVA
SVGDGQRCGLLLDKTNFYAEQGGQASDRGYLVLVGQQDVLFPVARAQVCGGFILHEVAAP
ELRVGDQVQLHVDEKRFREKHTTIHLLNWALREALGPGTEQRGSHLNPERLRFDVATQAP
LTPEQLRAVEVTVQKAVGRDEAVYMEEVALARTAHVPGLRSLDEVYPDPVRVVSVGVPVA
HALDPASRAALHTSVELCCGTHLLRTGAIGDLVIIGEFQLVKGITRLLAVTGEQAQQARE
VGQSLAREVEAAAARLSQGSRHVAEAHRLSKDIGRLTDAVDTAMMPQWQRRELQAALKAL
QRRANTAVRKLEMGQAAQKTQELLQRHTEGPLIVDTVSTESLSMLVKVVRQLCKQAPSTS
VLLLSPQPLGQVLCACQVAQSATPAFTAEAWALAVCSHMGGKAWGSRVVAQGTGSTADLE
AALSAARAYALNQL
Download sequence
Identical sequences W5PJ60
ENSOARP00000010480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]