SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010603 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000010603
Domain Number - Region: 81-227
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00145
Family Brix domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010603   Gene: ENSOARG00000009886   Transcript: ENSOART00000010760
Sequence length 306
Comment pep:novel chromosome:Oar_v3.1:8:26446501:26479614:-1 gene:ENSOARG00000009886 transcript:ENSOART00000010760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALDRVVKPKTKRAKRFLEKREPKLSENIKNAMLIKGGNANSTVTQVLRDVYALKKPYG
ILYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELG
IEKFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGL
EYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSM
KMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERKAEDEENKS
KRIKKN
Download sequence
Identical sequences F1MMB9 L8IWJ1 W5Q1T6
ENSOARP00000010603 ENSOARP00000016674 ENSBTAP00000022060 XP_004011249.1.66739 XP_004019050.1.66739 XP_005890282.1.15283 XP_010854906.1.44457 XP_019822767.1.53367 ENSBTAP00000022060 9913.ENSBTAP00000022060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]