SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010698 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010698
Domain Number 1 Region: 219-332
Classification Level Classification E-value
Superfamily F-box domain 5.89e-16
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010698   Gene: ENSOARG00000009978   Transcript: ENSOART00000010855
Sequence length 355
Comment pep:known_by_projection chromosome:Oar_v3.1:9:29178569:29210013:1 gene:ENSOARG00000009978 transcript:ENSOART00000010855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLGSYCSKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPALRGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQVAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCRHCHILSWKGTDHPCTANNPESCSISLSPQDFINLFKF
Download sequence
Identical sequences W5PJS7
ENSOARP00000010698 XP_004011706.1.66739 XP_005688922.2.57651 XP_011988603.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]