SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000010832 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000010832
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 4.97e-42
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000010832   Gene: ENSOARG00000010101   Transcript: ENSOART00000010990
Sequence length 223
Comment pep:known_by_projection chromosome:Oar_v3.1:18:7227943:7282513:-1 gene:ENSOARG00000010101 transcript:ENSOART00000010990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIVSGGIWNDRERKRVLSYTRVILSPRQELSKLGLGSDMDVELQTLQLPVDYREVKQR
VARIWKDLQPQFVVHVGVDPAAKAIFLEQCSKNRGYRDADIRGFRPECGVCLPDGPEVIV
SEVSMKAVSRRAAVQGVEVAFSRDAGRYVCDYAYYLSLHHGNGCAALIHVPPLSPRLPAS
LLGKALQVLIQEMLEEIEKGRAQNQKLSLCSSSRGEPTGGLLH
Download sequence
Identical sequences W5PK61
ENSOARP00000010832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]