SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011128 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011128
Domain Number 1 Region: 385-616
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-33
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 
Domain Number 2 Region: 82-238,376-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.44e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 
Domain Number 3 Region: 727-758
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000121
Family LIM domain 0.001
Further Details:      
 
Domain Number 4 Region: 694-726
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000333
Family LIM domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011128   Gene: ENSOARG00000010373   Transcript: ENSOART00000011288
Sequence length 1074
Comment pep:known_by_projection chromosome:Oar_v3.1:8:27816425:27825784:1 gene:ENSOARG00000010373 transcript:ENSOART00000011288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQGTLGLEPGGGLSQYHKIKAQLNYWSAKSL
WAKLDKRASQQVYQQGRACTGTKCLVVGAGPCGLRAAVELAMLGARVVLVEKRTKFSRHN
VLHLWPFTIHDLRALGAKKFYGRFCTGSLDHISIRQLQLLLLKVALLLGVEIHWGITFTG
LQPPPKKGSGWRAQLQPSPPAQLAKYEFDVLISAAGGKFVPEGFTVREMRGKLAIGITAN
FVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKKQCL
LRLGVLRQDWPDTERLLGSANVVPEALQRFARAAADFATHGKLGKLEFAQDAHGRPDVSA
FDFTSMMRAESSARVQERHGTRLLLGLVGDCLVEPLWPLGTGVARGFLAAFDAAWMVKRW
AEGAGTLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPSQVRDLY
DVEAKEPVQKMSDKTDSGKPATGEQAASRGAVGSQEELLRWCQEQTAGYPGVHVTDLSSS
WADGLALCALVHRLRPALLEPSEIQGMGALEATSWALKMAEHELGITPVLSAQAMVAGSD
PLGLIAYLSHFHSAFKSTPHNPGSVSQGSPGAATAVLFLGKLQRTLQRTRTQENGEDAGG
KKPRLEIEAETPSTEEPPVQEPDEPMTPPSQQQDASAEDLCALCGQHLYILERLCADGCF
FHRSCFRCRICEATLWPGGYGRHPGDGYFYCLQHLPQTGHKEDSSDRGPESQDLPMPSEN
NMPSGPMTPVAHHQGTSPVPNPSQPTRRLIRLSSPERQRLSTLHLTPDPEMEPPPKPPRS
CSALAHQALEASFRGWGMPVQSPQVLEAMEKGEEESSSSSEEETEEEEDVPLDSDMEQFL
RNLAKNSGTMNNYPTWRRTLLRRAREEEMKRFCKAQAIQRRLNEIEAALRELEARGTELE
LALRSQSSSPEKQKALWVEQLLQLVQKKNSLVAEEAELMITVQELNLEEKQWQLDQELRT
YMNREETLKTAADRQAEDQVLRKLLDVVNQRDALIRFQEERRLSELASEPGVQG
Download sequence
Identical sequences W5PL05
ENSOARP00000011128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]