SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011135 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011135
Domain Number 1 Region: 975-1018
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1219-1276
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 152-199
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 570-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000615
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 309-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1027-1096
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 1341-1405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000244
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 1102-1150
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 637-705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000523
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 10 Region: 710-762
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000785
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 11 Region: 1274-1329
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000968
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number 12 Region: 768-839
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 13 Region: 1154-1204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 895-970
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000641
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011135
Domain Number - Region: 840-897
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000209
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number - Region: 74-147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000746
Family TSP-1 type 1 repeat 0.015
Further Details:      
 
Domain Number - Region: 16-67
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00116
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number - Region: 453-515
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0131
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 371-451
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0405
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011135   Gene: ENSOARG00000010382   Transcript: ENSOART00000011295
Sequence length 1581
Comment pep:known_by_projection chromosome:Oar_v3.1:2:171843771:172610259:-1 gene:ENSOARG00000010382 transcript:ENSOART00000011295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECQHTTSFIYIFVLCHQHGPWGRCTGNCGPGGSQSRALWCFHSEGWTSHLSNCDEHNRP
PKERSCFRVCDWHRDLFQWEVSDWHHCVLAPPDLGPARPRAAACVTAQHGLQHRTVHCVQ
KLNRTMVVNEICEHFAPQPPTEQACLIPCPRDCVVSEFSPWSTCSNGCGKQLQHRTRSAI
ALPLYGGSQCPNLTESRACDAPISCPLGAEEYTFSLKVGPWSKCRLPHLKELNLSGRTVL
DFSSESKELVPFRHHSYKAHHHSKSWDIEIGFQTRQVWCTRSDGRNAVLSLCMQDSFPLT
VQSCIMPKDCETTEWSSWSPCSKTCRSGSLSPGFRSRSRNVKHVALGGGKDCPELLEKEA
CIVEGELLHLCPRYSWKTSEWKECQVSLLLEQQYLHWHEMGPICGGGIQTREVYCAQSTP
ASTAQRAKEVSRPVAKTLCLGPAPSASQLCSTPCSTDCIMSSWSAWGLCVHENCRDPQGR
KGFRMRQRHVLMESTGPAGRCPHLVESVPCEDPVCYQWLVSEGICIPDHGKCGPGHRILK
AVCQNEQGEDVSGSLCPSSPPPEQMACEIPCRMDCVVSEWTEWSSCSQSCSNKNSDGKQT
RSRTILALAGEGGKPCPPSQALQEYRSCNDHSCMQLYWETSPWGPCSEDTLVTALNATIG
WNGEATCGVGIQTRRVFCVKSHVGQVMTKRCPESTRPETVRACLLPCKKDCLVTAFSEWT
PCPRLCQPGNATIKQSRYRIIIQEAANGGQECPDTLFEERECEDVSLCSTYRWRPQKWSP
CVLVPESVRQGVMGTSETCGKGVQTRAVSCISDNNQSAEMTECLKQINGMPPLMQECVVP
CRDDCTFTAWSKFTPCSTNCETTRSRRRQLTGTGKSRKKEKCHDADLYPLVETEPCPCDV
FTSHPYGNWSDCILPESRKEPHRGLRLQGDTRECGEGLRFRAVACSDKNGRPVDPVHCNS
SGYIQEECVIPCPFDCKLSDWSSWGSCSSSCGIGVRIRSRWLKEKPYNGGRPCPKLDLKN
QVHEAVPCYTECNQYSWVVEHWSPCKIHNELRSLRCGGGTQSRKIRCMNAADGEGGAADK
SLCNQDEIPPETQSCSLLCPNECVMSEWGPWSKCPQSCDPHTMQRRTRHLLRPSLSSRTC
AEDSQVRPCLLNENCFQFQYNLTEWSTCQLSENATCGQGIRTRLLSCVRSDGKPVAMDEC
EQRNLEKPQRMNLHCLVECVVNCQLSGWTAWTECSQTCGLRGQRSRTRFILMPTQGEGRP
CPTELTQHKTCPMIPCYSWVLSNWSACKLEGGDCGEGVQTRSLSCVVHNGSISPWTVRVD
DALCREMPFQDSILKQPCSVPCPGDCHLTEWSEWSTCELTCIDGRSFETLGRQSRSRTFI
IQSFENQDSCPQQVLETRPCTGGKCYHYTWKASLWNNNERTVWCQRSDGINVTGGCSLQA
RPAAIRQCNPACRKPFSYCTQGGVCGCEKGYTEIMRSNGLLDYCMKVPGSEDKKADVKNL
AGKNRPVNSKIHDIFKGWSLQPLDPDGRVKIWVYGVSGGGFLIMIFLVFTSYLVCKKPKP
HQSTPPQQKPLTLAYDGDLDM
Download sequence
Identical sequences W5PL12
ENSOARP00000011135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]