SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011170 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011170
Domain Number 1 Region: 128-322
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.87e-59
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 749-860
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 3 Region: 445-547
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-37
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 594-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-36
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 329-438
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-36
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 885-978
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 7 Region: 549-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000257
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 702-746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family EGF-type module 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011170   Gene: ENSOARG00000010405   Transcript: ENSOART00000011330
Sequence length 989
Comment pep:known_by_projection chromosome:Oar_v3.1:2:43145400:43191146:-1 gene:ENSOARG00000010405 transcript:ENSOART00000011330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRAPRRPSPLRARRLLLLARPGRPLDLADYTYDLGEEDDAEPLNYKDPCKAAAFLGDIA
LDEEDLRAFQVQQAADLRQRATRRSSIKAAVSGNSSTLNSQNASMKPQRRSRGRWKSRSR
SRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIV
FTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIV
RENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKP
PIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPG
EKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFR
SSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCVWRIQVSEGFHVGLTF
QSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINK
AGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTK
LNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTA
DSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQD
CVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSSSGTITSPNWPDKYPSKKECTWAI
SSTPGHRVKLTFMEMDIESQPECAYDHLEVYDGRDAKAPVLGRFCGSKKPEPVLATGNRM
FLRFYSDNSVQRKGFQASHSTECGGQVRAEVKTKDLYSHAQFGDNNYPGGVDCEWVIVAE
EGYGVELVFQTFEVEEESDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVK
FHSDDTITKKGFHLRYTSTKFQDTLHSRK
Download sequence
Identical sequences W5PL47
ENSOARP00000011170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]