SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011212 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011212
Domain Number 1 Region: 306-419
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000605
Further Details:      
 
Domain Number 2 Region: 52-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.39e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011212   Gene: ENSOARG00000010451   Transcript: ENSOART00000011372
Sequence length 420
Comment pep:novel chromosome:Oar_v3.1:26:25493375:25522452:-1 gene:ENSOARG00000010451 transcript:ENSOART00000011372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRIIKEKRDAYVSRLNTIYQNNL
TKSHIDIIHGHAAFTCDPQPTVEVSGKKYTAPHILIATGGVPSVPQESQIPGASLGITSD
GFFQLEELPRRSVIVGAGYIAVEIAGILSALGSKTSIMIRHDKVLRTFDSIISSNCTEEL
ENAGIEVLKYSQVREVKKTSSGLELRMVTSIPGRKPTFTTIADVDCLLWAIGRDPNSWGL
NLNKLGIQTDDKGHIIVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKE
DSKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTTFTPMYHAVTKRKTKCV
MKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKSDFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences W5PL89
ENSOARP00000011212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]