SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011302 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011302
Domain Number 1 Region: 380-669,778-820
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.88e-71
Family FAD-linked reductases, N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 654-768
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.38e-25
Family L-aminoacid/polyamine oxidase 0.00026
Further Details:      
 
Domain Number 3 Region: 270-376
Classification Level Classification E-value
Superfamily Homeodomain-like 3.31e-19
Family SWIRM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011302
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0304
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011302   Gene: ENSOARG00000010531   Transcript: ENSOART00000011462
Sequence length 821
Comment pep:known_by_projection chromosome:Oar_v3.1:20:38320034:38360550:-1 gene:ENSOARG00000010531 transcript:ENSOART00000011462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASTSERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAAKPE
TSDHCSLPEDLRVSEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTRRV
TSDASPGKLEHPKAVPSVLVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSR
DPTMYLALRNLVLALWFTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLI
NTGVLSVGPDQHLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVW
DDKSFTGVTVGRGAQIVNGCVNNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKR
MDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEEQVLQFHLSN
LEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVILEKLAEGLDIRLRSPQVQSI
DYSGDEVQVATADGTVCTAQKVLVTVPLALLQKGAIQFNPPLSDKKMKAINSLGAGIIEK
IALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKQHSVLMSVIAGEAVAAV
RSLEDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDI
LAEEIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences W5PLH9
ENSOARP00000011302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]