SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011416 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000011416
Domain Number - Region: 98-136
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0068
Family Troponin I 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011416   Gene: ENSOARG00000010644   Transcript: ENSOART00000011576
Sequence length 171
Comment pep:known_by_projection chromosome:Oar_v3.1:3:7917317:7922023:-1 gene:ENSOARG00000010644 transcript:ENSOART00000011576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALDPPSLQRPPSRGPRTPGLRRWARRTILCPLPNRIQSGFTAVPPLHTPTVPLTSSLGFL
CRIQPGLSKSCGGAFRSPRPSPKPGQADRASEDSLQLNIQKLKEKKDMLDKEISQLLSEG
YSVDELEDHISQLHEYNDIKDAAQMLLGRLAVIRGVTTKELYPEFGLDMND
Download sequence
Identical sequences W5PLU2
ENSOARP00000011416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]