SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011524 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011524
Domain Number 1 Region: 3869-4062
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-37
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 4525-4731
Classification Level Classification E-value
Superfamily Fibronectin type III 2.41e-34
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 4728-4928
Classification Level Classification E-value
Superfamily Fibronectin type III 1.95e-33
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 4 Region: 4151-4352
Classification Level Classification E-value
Superfamily Fibronectin type III 7.63e-33
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 3585-3755
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-33
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 4352-4526
Classification Level Classification E-value
Superfamily Fibronectin type III 3.03e-30
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 7 Region: 1053-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-30
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 2330-2534
Classification Level Classification E-value
Superfamily Fibronectin type III 4.98e-30
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 9 Region: 1516-1680
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-30
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 10 Region: 2623-2821
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-29
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 11 Region: 1709-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-29
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 12 Region: 2143-2330
Classification Level Classification E-value
Superfamily Fibronectin type III 3.59e-29
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 13 Region: 2819-3020
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-28
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 14 Region: 1243-1288,1319-1421
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-26
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 15 Region: 2009-2140
Classification Level Classification E-value
Superfamily Fibronectin type III 8.15e-24
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 16 Region: 4019-4151
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-21
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 17 Region: 3020-3150
Classification Level Classification E-value
Superfamily Fibronectin type III 7.16e-21
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 18 Region: 2528-2626
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-20
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 19 Region: 123-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.42e-17
Family Clostridium neurotoxins, the second last domain 0.054
Further Details:      
 
Domain Number 20 Region: 3456-3536
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000958
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 21 Region: 1425-1508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000369
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 22 Region: 1908-1995
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000752
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 23 Region: 3756-3863
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000127
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 24 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000698
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 25 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 26 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 27 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 28 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 29 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 30 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 31 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000212
Family Laminin-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011524
Domain Number - Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000963
Family Laminin-type module 0.086
Further Details:      
 
Domain Number - Region: 283-459
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00748
Family beta-mannanase CBM 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011524   Gene: ENSOARG00000010714   Transcript: ENSOART00000011686
Sequence length 5197
Comment pep:known_by_projection chromosome:Oar_v3.1:12:16999001:17981947:-1 gene:ENSOARG00000010714 transcript:ENSOART00000011686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCLALSLGFSLLFPVPETWLFAYFASISWADSQGLFPRLENVAAFKKVSVVPTQATCGI
PAQSTFCQSSATPEGLRVCPQRLCVQDCPYRSSPPTYTNLFSAGLRGCIIRDQRDLSPNS
HNHTASFIFGNHQSCFASPPASRLAASFTLAVWLKLEQGGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGLEKDNAAFDAR
TLSGSVTDFASGAMQIGQSLNGSEQFVGRMQDFRLYQVALTNREIQEVFSGDLPRLHIQS
HCRCPGSHPRVHRLEQQYCIPSDAEDTTKNRVLRLNPEAHPLSFVNDNNIGTSWVSHVFT
NMTQLSQGVTISIDLENGQYQVFYIIIQFSSPQPTAIRIQRKKEDSLDWEDWQYFARNCS
TFRMKNNGDLETSDSVNCLQLPNFTPYSCGNVTFSILTPGQNQRPGYNNFYTTPSLQEFV
KATQVRLHFHGQYHTTETAVSPRHRYYGVNEITITGRCQCYGHANRCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNNKPFRQSDHVHAFNCKPCECNSHSRSCHYNISVDPFPLEHYRG
GGGVCDDCEHNTAGKNCEQCKDYFFRQVGADPSAIDVCRPCDCDKVGTRNRSFLCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQEWDPDGCSPCNCNTSGTVDGDITCHPNSGQCKCKAN
VIGLRCDHCNFGFKFLQSFNDDGCEPCQCNLHGSVNRLCNPLSGQCECKKEAKGLQCDTC
REHFYGLDATGCKACDCDVAGSQSGTVCDAWTGQCVCKPNVGGRRCSECVEGYFYQRQNH
SFLCLPCSCDRTGTINGSLLCDKSTGQCPCKLGVTGLHCNQCEPHRYNLTVGSFQGCQMC
ECDPLGTLPGNICDPLSGQCPCLPSRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQSCDYCKDLYFGFDSLTGRCQPCNCHLSGALNETCHSVTGQ
CFCKRFVTGSKCDTCVPNASHLDISNPLGCSKTPSQQPPPRGQVQSSSAINLSWSPPDSP
NAHQLTYSLFRDDFEIYTVEDQYPYNIQYFLDTALVPYTSYSYYILTSSVHGSTRSAAVT
YRTKPGAPVGSLNLSYISPVSSDSVTLTWVSASNRSGPIEKYILSCAPLHGVQPCSPYEG
PETTTTIWNLLPFTKYRFAVQACTSGGCLHSTPLTVITAQAAPRRLGPPKVRKISSTELH
VEWAPPMEPNGIIIRYELYMKRLKSNGETRSAESQVFQSSGWLSPHPLAESANENALEPP
ETTTVITGLEPYTKYKFRVLAVNMAGSVFSAWTTGRTGESAPVFVMPPSVSPLSPHSLNV
SWEIPPDSVTRGKVVGYNINMISEQSPQWSHPVVVPQVLYTAKSQELSYIVKGLKPYRIY
NFTISLCNSVGCVTSASEAGQTLASAPAQLRPPLVEGINSTTMHLRWLAPEEQNGPSPVY
QLERREPSLPAPRATVMKGTRFTGHGYYKFPSSTHPVNTDFTGIKASFRTRVPEGLIVFA
ASPGNQEEYFAIQLKNGRPYFLFDPQGSAVEVTTTNDDGKQYSDGKWHEIIAIRHQGLGQ
ITLDGLFTGSSATLDGGTVIGENTGVFVGGLPQGYTILRKDSDIVQKGFVGCLKDVYFMK
NFNPSATWERLVWQSSEEKTNVHNDWEGCPASLQEGAQFLGTGFLELYPYLFHGGMDFEI
SFKFRTDQLNGLLLFIYNKDGPDFLAMELKSGILSFRLNTSLTFTQVDLWPGLSYCDGKW
NKVIIKKNDSVISASMNELMERVSESRAQALMVNSPVYVGGIPQELHDSYKHLKLEQGFG
GCMKDVKFARGAVINLASVSSGAVRVNLDGCLSTDSAAKCRGNDSILVYQGEERTTYESH
LQPFTEYLYRVTASHEGGSVHSDWSRGRTTGAAPQSVPAPSGVRSINGYSIEVTWDEPVV
ARGVIEKYILRAYSEDAPGPPHMPSASSELVDTNTFTGILTGLLPFKNYAVTLAACTLAG
CTESLHALNISTPQEAPQQVQPPVAKSLPHSLLLSWNPPQKANGIITQYSLYMDGMLIYS
GNGENYTVTDLAAFTPHQFLLSACTHVGCTNSSLVILSTAQLPPEHVDPPILTVLDSRTV
YIQWKQPRKVNGILERYILYISNHTHDFTVWDVIYNNTELFQDHTLQYLLPGNKYLIKLA
ACTGGGCTVSKASQALTEERTPEGVPAPRVNPDSSHSFNISWTEPEYPNGVITSYGLYLD
GILIHNSSELSCHASGFAPWSLHSFRVQACTARGCALGPLVENRTLEAPPEGTVNVFVKT
EGSRKAHVRWEPPFHPNGRLIYSVLFTGTFYADQVGDNYTLLNGTRIMHSGEETSLWVLI
NGLVPFTNYTVEVNASNSQGSLMSDPVMISMPPGAPDGVLPPRLSSATPTSLQVVWSTPA
RNNAPGSPRYQLQMRPGHSTHGFLELFSNPSASLNYEVRDLQPYTEYEFRLVASNGFGSA
HSSWILFITAEDKPGPVDPPVILDKKSRMMLVTWQHPLKCNGLITHYNIYQHGRLSLKTS
GNVTNGTVTHLRPYTAYTFQVEACTSKGCSLSADSQTIWTLSDAPEGILSPELFSDTPTS
VIISWQAPTHPNGLVENSTIQRRVQGKEAVTTLVTLPGSHPRRFIDKTSALSPWTKYEYR
VLMSTADGGTNSSDWAEVTTRPSRPAGVQPPEVDVLGPDAAKVTWKPPLILNGDILNYEI
RMPDPHIKITNVTSVLSHVVTHLIPFTNYSVTIVACSGGNGYLGGCTESFPTHVTTPPAL
PQDLGPLSVVPLSESYVGISWQPPSRPNGPDLRYELLRCKIQQPLASNPPEDLNMWHNIY
SGTQRFYEDKGLSRFTTYAYKVFVHNSVGFTSSQEVTVKTLAGLPERGANVTAVVLNHTA
IDVRWVKPTFQDLQGDVEYYTLFWSSATSNESRKILPDVNSHVIGHLNPNTEYRIFISVF
NGVASINSEVLHATTCDGEPQGMLPPEVVIINSTAVRVIWTAPSNPNGVVTEYSVYVNNQ
LYKTGINVPGSFILRELSPFTVYDIQVEVCTKYACVKSNRTQITTVEDTPSDIPTPTIHG
ITSRSLQIEWMSPGRPSGIILGYDLLRKTWRPCSKTKKLMKDHTGGLCKAVECQKHELLC
GTRCYSPEAKVCCNGALYDPQPGHACCEKYIAFVSNLTGVCCGGRIRETQPNHQCCSGYY
VRILPGEVCCPDEQHNRVSAGLGNSCCGRMPFSTSGKQICCAGRLHDGHGQQCCGGQIVS
KDFECCGGQEEGVVYSRLPGMFCCGLDYVNMSDTICCSASSGESKAHVKKNDPVPVKCCE
TELIPKSQECCNGVGYNPLKYVCSDKISTGMMMKETKACRTLCPASMEATAQCGRCDFNS
TSHVCTVIRGSHSSIRKDSMEEICSSAEETVHTGSVNTLSFTDVNLEPYMMYEYRISAWN
RYGRGFSKAVRARTKEDVPEGVSPPRWTKMDHLDDVIVLSWKKPIQSNANIIWYFNLLER
SMEEVEAMSLNMEERLGIIPKRLPIYTVQSILYASKVVAATTQGIPQNIPPPRVTAPSAE
ALHVSWHVPPKPNGVIKEYQLRQVGKGLIYTDTTDRRQHTVTGLQPYTNYSFTLRACTSA
GCTSSEPFLGQTLQAAPQGVWVTPRHIVINSTTVELFWSPPEKPNGLISQYQLSRNGSLI
FVGGSEEQNFTDKNLEPNSRYVYKLEATTGGGSSPSDEYIIQTPILTPEEIQPPYNITVI
GPYSIFVAWTPPGILVPKMPVEYSVLLNAGSATPLISSVGHHQSSLLENLAPFTQYEIRI
QACQKGGCGVSSRMFAKTAEAAPMDLNSPVLKALGSACIEVKWMPPKKPNGVIINYFIHR
RPTGTEEESLVFVWSEGALEFIDDADTLRPFTLYEYRVRACNSRGSVESLWSSARTLEAP
PQDFPAPWAQVTGAHSVLLNWTEPDSPNGIIFQYRVVYQQKTDDPTLNFSAVHAFTVMGT
SYQAHLFGLEPFTTYHVGVVATNQAGEVSSPWTLVQTLESSPSGLSNFTVEQKENGRALL
LQWSEPARTNGVIKTYNVFSEDVLEYTGLNRQFLFRRLDPFTLYTLTLEACTRAGCAHSA
PQPLWTEEAAPHSQPAPTIQSVGSTSVELSWSEPIKPNGKIIRYEVIRRCFEGKAWGNQT
IQADEKIVFIESNTERNTFIYNDTGLQPWMQCEYKVHAWNSAGHTCSSWSGVRTRQAPPD
GLCPPEVAQVSVNPPKVLIAWVSPEQPNGIIQSYRLQRNGVLYPFSFDAVTFNYTDEKLL
PFSTYSYGVTACTSGGCSASTTTSITTLEAAPAGVHPPALRTISATQINVSWSPPSIQNG
EITQYLLRLDGKEYPAGQNLTLLVSHLQPYTQYNFSLVACTKGGCTASVPESAWTMEAPP
QNMDPPKLQVTGSESIEITWKLPRIPNGRIRSYELRRDGTIVYTGLETRYHDFTLTPGVE
YGYTVMANNSQGGVLSPLVKDRTSPSAPSGMEPPRLLAKGPQKILVTWDPPVRTNGHIVN
YTLFIRELFERETKMIHINTTHNSFGPQSFTVNQLKPFHRYEVRIQACTRLGCVSSDWVS
TETLEVAPRQQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQIATQPEKS
KLVLAYNGSSSSFKDVQLLPFTEYEYQVWAVNSAGKAPSSWTRCRTGPAPPEGLRAPKFH
VVSATQAVVNISAPRKPNGIVTLYRLFSRSTSGAQTVLAEGLATQQTLHGLQPFTTYSIG
VEACTCFNCCSQGPTAELRTPPAPPAGLSSPQIQMLASRTASFQWSPPLFPNGVIQSYEL
QLYKACPPDSATPCTPSQIETKYRGPGQRASLEGLQPYTTYKLRVVAHNAVGSTATEWIS
FVTQKELPQYRAPFSVDSNLSVVCVNWSDSFLLNGRLKEFVLTDRGQRLYSGLDTTLYIP
RTADKTFFFQVICTTEEGSAKTPLIQYDTSTGFGLVLTTPGEKKGSGSKSMEFYSELWFI
VLMAVLGLILLAIFLSLILQRKIRKEPYIRERPPLVPLPKRTSPLNVYPPGETHVGLADT
KIPQSGTPVSIRSSRSLSVLRIPSQSHGRAYSQGSLHRSVSQLMDIQDKKVLIDDSLWET
IMGHDSGLYVDEEDLMNAIKGFSSVTKEHTTFTDTHL
Download sequence
Identical sequences W5PM49
ENSOARP00000011524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]