SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011669 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011669
Domain Number 1 Region: 94-135
Classification Level Classification E-value
Superfamily Globin-like 0.0000000000732
Family Globins 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011669
Domain Number - Region: 1-34
Classification Level Classification E-value
Superfamily Globin-like 0.00139
Family Globins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011669   Gene: ENSOARG00000010888   Transcript: ENSOART00000011837
Sequence length 135
Comment pep:novel chromosome:Oar_v3.1:24:133194:134250:1 gene:ENSOARG00000010888 transcript:ENSOART00000011837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTRAERTIVVSMWSKISTQADVIGTETLERRVTCVSRGPAPGSPQSRGRREAGRKGRN
DLETGGQGEGAGRTGQRLLRSRLRACTLSFPPQFLSHCLLVTLASHFPADFTADAHAAWD
KFLSLVSGVLTEKYR
Download sequence
Identical sequences W5PMJ4
ENSOARP00000011669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]