SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011694 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011694
Domain Number 1 Region: 17-382
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.32e-76
Family Regulator of chromosome condensation RCC1 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011694   Gene: ENSOARG00000010905   Transcript: ENSOART00000011862
Sequence length 385
Comment pep:known_by_projection chromosome:Oar_v3.1:24:32581660:32607844:-1 gene:ENSOARG00000010905 transcript:ENSOART00000011862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAARPPPPPASPPRRRIQAVPYRLELDQKISSAACGYGFTLLSSKTKDITKVWGMGLNKD
SQLGFHRSRKDKTRGYEYVLEPSPVPLPLDRPQETRVLQVSCGRSSACFVGNGEGVFSMG
NNSYGQCGRKVVENEIYSESHRVHRMQDFDGQVVQVACGQDHSLFLTDQGEVYSCGWGAD
GQTGLGHYNITSTPTKLGGDLAGVNVVQVATYGDCCLAVSADGGLFGWGNSEYLQLASVT
DSTQVNVPRCLPFSGVGQVKQAACGGTGCAVLNGEGHVFVWGYGILGKGPNLLETALPEM
IPPTLFGLAEFNPGVQVSRIRCGLSHFAALTNRGELFVWGKNIRGCLGIGRLEDQYFPWR
VTMPGEPVDVACGVDHMVTLARSFI
Download sequence
Identical sequences W5PML9
ENSOARP00000011694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]