SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011732 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011732
Domain Number 1 Region: 215-446
Classification Level Classification E-value
Superfamily RNI-like 1.41e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.00000000216
Further Details:      
 
Domain Number 2 Region: 141-198
Classification Level Classification E-value
Superfamily F-box domain 6.67e-16
Family F-box domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011732   Gene: ENSOARG00000010940   Transcript: ENSOART00000011900
Sequence length 476
Comment pep:novel chromosome:Oar_v3.1:16:37966646:38001104:-1 gene:ENSOARG00000010940 transcript:ENSOART00000011900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLGWNVDRVRGFRCTRSAPHAVRRRAPKREFGGRAPLQLMHAFKTPEPADAMHRKHLQE
IPDQSSNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPQELLSNLGHPQSPPRK
WLKSKGDDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSSVCKRWY
HLAFDESLWQTVDLAGRNLYPDVVGRLLSRGVVAFRCPRSFMDQPLVEHFSPFRLQHLDL
SNSVIDVSTLQGLLSHCSKLQNLSLEGLRLSDPVVDNLAQNTNLLRLNLSGCSGFSESAL
KTLLSSCSRLDELNLSWCYDFTEKHVQVAVAHVSETITQLNLSGYRKNLQRSDVSTLVGR
CPNLVHLDLSDSVMLKNDCFPEFYQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVF
GIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLSLEKPSCL
Download sequence
Identical sequences W5PMQ7
ENSOARP00000011732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]