SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011736 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011736
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Globin-like 4.46e-44
Family Globins 0.000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011736   Gene: ENSOARG00000010944   Transcript: ENSOART00000011904
Sequence length 143
Comment pep:novel chromosome:Oar_v3.1:24:154448:155145:1 gene:ENSOARG00000010944 transcript:ENSOART00000011904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAADKSNVKAAWGKVGGNAGARGVRAARRAMFLSFPTTKTYFPHFDLSHGSAQVKGH
GEVVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKLLSHTLLVTLACHLPNDFT
PAVHASLDKFLANVSTVLTSKYR
Download sequence
Identical sequences W5PMR1
ENSOARP00000011736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]