SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011766 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011766
Domain Number 1 Region: 264-472
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.53e-56
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 561-617
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000288
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 1082-1140
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000615
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1359-1418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000068
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1532-1592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 1660-1709
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000249
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 7 Region: 1595-1655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 8 Region: 968-1028
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 9 Region: 1306-1362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1025-1083
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 11 Region: 1213-1274
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 12 Region: 1423-1477
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 13 Region: 1163-1218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 14 Region: 1475-1533
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000824
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000011766
Domain Number - Region: 852-908
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000112
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number - Region: 913-968
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00432
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011766   Gene: ENSOARG00000010962   Transcript: ENSOART00000011937
Sequence length 1915
Comment pep:known_by_projection chromosome:Oar_v3.1:19:36783834:36942553:1 gene:ENSOARG00000010962 transcript:ENSOART00000011937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAGRKDRLHPRQVKLLETLSEYEIASPVRVNALGEPFPTNVHFKRRRRSINSASDPWPG
FASSSSSATSSSQEHYRLSAFGQQFLFNLTAHAGFIAPMFTVTLLGAPGVNQTKFYSEEE
AELKHCFYKGHVNTKSEHTAVISLCSGMLGTFRSHDGDYFIEPLLSIDEQEDEEAQNKPH
IIYRHSTRHREPATARHACDTSEHRNSHSKDKRKTRTRRWRGRSSLADDMLNSSFTTSTL
PANGSKTDSTREKGTHRRTKRFLSYPRFVEVMVVADNRMVLYHGANLQHYILTLMSIVAS
IYKDPSIGNLINIVIVNLVVIHNEQEGPSISFNAQTTLKNFCQWQHSKNHPGGIQHDTAV
LVTRQDICRAHDKCDTLGLAELGTICDPYRSCSISEDSGLSTAFTIAHELGHVFNMPHDD
NNKCKEEGIKSPQHVMAPTLNFNTNPWMWSKCSRKYITEFLDTGYGECLLNEPEYRPYPL
PHQLPGLLYNVNKQCELIFGPGSQVCPYMMQCRRLWCNNVDGAHKGCRTQHTPWADGTEC
DEPGKHCKFGFCVPKEMEVPVTDGSWGSWSHFGTCSRTCGGGIKTAIRECNRPEPRNGGK
YCIGRRMKFKSCNTEPCPKQKRDFRDEQCAHFDGKHFNINGLHPNVRWVPKYSGILLKDR
CKLFCRVAGSTAYYQLRDRVIDGTPCGQDTNDICVQGLCRQAGCDHVLNSKARRDKCGVC
GGDNSSCKTVAGTFNTVHYGYNVVVLIPAGATNIDVRQHSFSGKSEDDNYLALSSSKGEF
LLNGDFVVTMSKREIRIGNAVIEYSGSDNVVERINSSGRTEQELLLQVLSVGKLYNPDVR
YSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKRKPICTRESDQLTVSDQRCDRLPQPA
PITEPCGTDCDLRWHVASRSECSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDSFCSSHPK
PSNQEKCSGECNTGGWRYSAWTECSKSCDGGTQRRRAICVNARNDVLDDSKCTHQEKVTI
QKCSEFSCPEWKSGDWSECLVTCGKGHKHRQVWCQFGKDRLNDRVCDPETKPTSMQTCQQ
PECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSC
QPPPAAPEARRSTHSAPRTQWRFGSWTPPNTQCSATCGKGTRMRYVSCRDEDGSVADDSA
CATLPRPVAKEECSVTPCGQWKALDWNPCSVTCGQGRTTRQVVCVNYSDHVIDQSECDPD
YIPETDQDCSMSPCPQWTPDTDLSQNPFLNEDYHPRSISPSRTHVLGGNQWRTGPWGACS
STCAGGSQRRVVVCQDENGYTANDCVERIKPDEHRACESGPCPQWAYGSWGECTKLCGGG
LRTRLVVCQRPSGERFPDLSCEILDKPPDREQCNTHACPQDAAWSAGPWSSCSVSCGRGH
KQRNVYCMAKDGSHLESDFCKHLAKPNGHRKCRGGRCPKWKAGAWSQCSVSCGQGVRRRN
VGCQMGTHKTARETECNPYTRPESERACQAPPCPLYAWRAEEWQECTKTCGEGSRYRKVV
CVDEDRGGEVHGVHCGMSTRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCS
EIYTGKENYEYSYQTTINCPGMQPPSVQPCFLRECPVSATWRVGNWGSCSVSCGVGVMHR
SVQCLTNDDQPSHLCPADLKPEERKTCHNIYNCELPQNCKEVKRLKGASEDGEYFLVVTG
KLLKVFCAGMHSDHPKEYMTLVHGDSENFSEVYGHRLHNPTECPYNGSRRDDCQCRKDYT
AAGFSSFQKVRIDLTSMQIITTDLQFARTNEGHPVPFATAGDCYSAAKCPQGRFSINLYG
TGLSLTESARWISQGNYAVSDIKKSPDGTRVVGKCGGYCGKCAPSSGTGLEIRVL
Download sequence
Identical sequences W5PMU1
ENSOARP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]