SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011789 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011789
Domain Number 1 Region: 162-202
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000575
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011789   Gene: ENSOARG00000010993   Transcript: ENSOART00000011961
Sequence length 405
Comment pep:known_by_projection chromosome:Oar_v3.1:13:6356637:6387888:1 gene:ENSOARG00000010993 transcript:ENSOART00000011961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNNLNMESALTSETSFPPSKEALGEHSEHQAGHQPFPRQQFQQEAGHPSLQRDGPRSFLL
DLPNFPDLSKADINGQNPNIQVTIEVVDGPDSEAEKDQHPENKPGSLALPRAQGGDQDYK
YDGTSDDSNFLSPPGGWDRPAPGHRTFETKEQPEYDSTDGEGDWSLWSVCSVTCGNGNQK
RTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCER
WMSCKSEFLKKYMHKVINDLPSCPCSYPTEVAYSTADIFDRVKRKDFRWKDASGPKEKLE
IYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLISTEFSAELHYKVD
ILPWILCKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences W5PMW4
ENSOARP00000011789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]