SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011901 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000011901
Domain Number 1 Region: 591-749
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0016
Further Details:      
 
Domain Number 2 Region: 729-844
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-23
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 3 Region: 46-148
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-20
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011901   Gene: ENSOARG00000011100   Transcript: ENSOART00000012075
Sequence length 900
Comment pep:known_by_projection chromosome:Oar_v3.1:2:49199068:49241910:1 gene:ENSOARG00000011100 transcript:ENSOART00000012075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDAQENTAESGSSVQWSEEPAGLAKVPEVSLSEESEGCTRPLEAAPPKLCGYLSKFGGK
GPIRGWKSRWFFFDERKCHLYYSRTAQDANPLDSIDLSSAVFDCKADAEEGTFEIKTPNR
IITLKAATKQVMLYWLQQLQMKRWEFHNSLPAPPAAPDAALAGNGPALRLELEQEEEDQE
ALLCPVKTPTELVGVGAAWQPVHAKPSALQNISLKHLGTEIQNTMCSIRGNKQTQGAGHR
PPGEDSPLSEETQREEQLSPPDPGTPGKDPANSQKPTPKSSLTTSLIQKAKSQSNTFPLF
SEGLMRNRTAQEKVLALEQQVLMLTKELKAQKELVKILHKALEAAQQEKRVSSAYLAAAQ
DKDRLELVRHKVRQIAELGRRVEALERERESLVQTASLREQEIQELQQHVQLLLDKNQAK
QEVICKLSEKVTQDFMKAPEEADRDFLSQQEKMEHLKDDMEAYRTQNRFLNSEIHQVTKI
WTKVAEKEKALLMKCAYLQAQNCRVESKYLAGLRRLQEALGVEAGECSELLRQLIQEALQ
WEASEASADSIVLSPGTVSEYDEYGFLTVPSYEVEDLRLLAKIQALEVHSHRLLRAGVPH
EHRPRVWRWLIRLRVQRLQAPGCYQALLSQGQACKHPAARQIELDLNRTFPNNKHFTCPT
SSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAMALLVLDEEESAFWCLVAIVETIMPADY
YSKTLLASQVDQRVLQDLLLEKLPRLMAHLGQRRVDLSFITFNWFLVVFADSLISNILLQ
VWDAFLYEGIKVVFRYALAIFKYNEEALLRLQDSLEIYQYLHFFTKTICDSRKLMHIAFN
DMNPFPMKQLRQLRAAHRERLEAELNELEQLKAEYLETRAAQGPSVPEGCPSEDEGEAEP
Download sequence
Identical sequences W5PN75
XP_004004277.2.66739 ENSOARP00000011901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]