SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000011968 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000011968
Domain Number - Region: 122-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0235
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000011968   Gene: ENSOARG00000011166   Transcript: ENSOART00000012142
Sequence length 186
Comment pep:known chromosome:Oar_v3.1:6:112580021:112580685:1 gene:ENSOARG00000011166 transcript:ENSOART00000012142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDFPPSCGPVGEEPAGPESCAPSRDPPLLRRAAEGYASCLLPGAGARPEIEALDASLED
LLTRVDEFVGMLDMLRGDSSHVVGEGVPLIYAKATEMRRVYSKIDRLEAFVGMVSASVAR
LEEQVARAEAELGTFPSTFRKLLHTINVPSFFHKAPPGRSQLTGYEPPVVFRTEDHFPCC
SERPQV
Download sequence
Identical sequences W5PNE2
ENSOARP00000011968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]