SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012029 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012029
Domain Number 1 Region: 1958-2120
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-43
Family C-type lectin domain 0.000000349
Further Details:      
 
Domain Number 2 Region: 486-593
Classification Level Classification E-value
Superfamily C-type lectin-like 7.59e-42
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 6.91e-40
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 597-712
Classification Level Classification E-value
Superfamily C-type lectin-like 2.93e-32
Family Link domain 0.0041
Further Details:      
 
Domain Number 5 Region: 261-355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.4e-28
Family Link domain 0.0026
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000019
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 7 Region: 2121-2180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012029   Gene: ENSOARG00000011225   Transcript: ENSOART00000012205
Sequence length 2206
Comment pep:known_by_projection chromosome:Oar_v3.1:18:19520823:19560023:1 gene:ENSOARG00000011225 transcript:ENSOART00000012205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLLVFVTLRVVAAAISVEVSEPDNSLSVSIPEPSPLRVLLGSSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRISKEKEVVLLVATEGRVRVNSAYQDKVTLPNYPAIPSDATLEI
QNLRSNDSGIYRCEVMHGIEDSQATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQGGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITIQTVTWPDVELPLPRNITEGEARGNVILTAKPDFEVSPTAPEPEEPFTF
APEVRATAFPAVENRTGEATWPWAFPRESTPGVGAPTAFTSEDLVVQVTLAPGATEVPGQ
PRLPGGVVFHYRPGSSRYSLTFEEAKEACLRTGAVIASPEQLQAAYEAGYEQCDAGWLQD
QTVRYPIVSPRTPCVGDKDSSPGVRTYGLRPPSETYDVYCYVDRLEGEVFFATRLEQFTF
REAQEFCESQNATLATTGQLYAAWSRGLDKCYAGWLSDGSLRYPIVTPRPACGGDKPGVR
TVYLYPNQTGLLDPLSRHHAFCFRGVSVVPSPGEEEGSTPTAGPEVEDWIVTEVGPGVAA
VPVGEETTAVPGFTVEPENKTEWELAYTPAGTFPLPGIPPTWPPTGEATEEHTEGPSATE
VPSASEKPFPSEKPFPPEELFPSEKPFPSEKPFPSEKPFPSEKPFPSEKPFPPEELFPSE
KPIPSEEPFPSEEPFPSEKPFPSEEPFPSEKPIPSEEPFPSEKPIPSEEPFPSEEPSTLS
APVPSRTELPTSGEASGVPEVSGDFTGSGEISGHLDFSGQPSGESASGLPSEDLDSSGLT
PTVGSGLPVESGLPSGEEERITWTSPPIVDRLPSGGEGPEVSASGVEDISGLPSGGEVHL
EISASGVEDLSRLPSGEGPEVSASGVEDLSGLPSGEEGHLEISASGVDLSGIPSGEGPEV
SASGVEDLSGLPSGEEGHLEISASGVDLSGIPSGEGPEVSASGVEDLGVLPSGEGHLEIS
ASGVEDLSRLPSGEEGHLEISASGVDLSGIPSGEGPEVSASGVEDLSVLPSGEGHLEISA
SGVEDLSRLPSGGEDHLETSASGVGDLSGLPSGREGLEISASGAGDLSGLTSGKEDLTGS
ASGALDLGRIPSVTLGSGQAPEASGLPSGFSGEYSGVDLGSGPSSGLPDFSGLPSGFPTV
SLVDTTLVEVVTATTAGELEGRGTIDISGAGETSGLPFSELDISGGASGLSSGAELSGQA
SGSPEISGETSGLFGVSGQPSGFPDISGETSGLLEVSGQPSGFSGEISGVTELSGLPSGQ
PEISGEASGILSGLGPPFGITDLSGEAPGIPDLSGQPSGLPEFSGTTSGVPDLVSSAVSG
SGESSGIMFVDTSLVEVTPTTFKEEEGLGSVELSGLPSGEAGLSGTSGLVDVSGLSSGAI
DSSGFTPQPPEFSGLPSGVTEVSGEASGAASGSSLPSGAYDSSGLPSGFPTVSFVDRTLV
ESVTQAPTAQEAGEGPSGILELSGTPSGAPDMSGDHLGSLDQSGLQSGLVEPRGEPASTP
YFSGDFSGATDVSGESSAATSTSGEPSGLPEVTLITSELVEGVTEPTVSQELGQRPPVTY
TPQLFESSGEASVSGDVPRFPGSGVEASPVPESSGETSAYPEAEVGASAAPEASGGASRS
PNLSETTSTFHEADLEGTSGLGASGRPSAFPEGPTEGLATPEVSGESTTAFDVSVEASGS
PSATPLASGDRTDTSGDLSGHTSGLDIVISTTIPESEWTQQTQRPAEARLEIESSSPVHS
GEESQTADTATSPTDASIPTSTGGTDDSEATTTDIDECLSSPCLNGATCVDAIDSFTCLC
LPSYQGDMCEIDQKLCEEGWTKFQGHCYRHFPDRATWVDAESQCRKQQSHLSSIVTPEEQ
EAVNSNAQDYQWIGLNDKTIEGDFRWSDGHSLQFENWRPNQPDNFFATGEDCVVMIWHEK
GEWNDVPCNYQLPFTCKKGTVACGEPPVVEHARIFGQKKDRYEINALVRYQCTEGFIQRH
VPTIRCQPSGHWEEPRITCTDPATYKRRLQKRSSRPLRRSRPSTAH
Download sequence
Identical sequences W5PNK3
ENSOARP00000012029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]