SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012032 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012032
Domain Number 1 Region: 73-259
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.11e-49
Family Astacin 0.00025
Further Details:      
 
Domain Number 2 Region: 430-603
Classification Level Classification E-value
Superfamily TRAF domain-like 4.41e-40
Family MATH domain 0.00072
Further Details:      
 
Domain Number 3 Region: 267-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-30
Family MAM domain 0.0048
Further Details:      
 
Domain Number 4 Region: 674-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000802
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012032   Gene: ENSOARG00000011224   Transcript: ENSOART00000012208
Sequence length 748
Comment pep:known_by_projection chromosome:Oar_v3.1:20:20073505:20103102:1 gene:ENSOARG00000011224 transcript:ENSOART00000012208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWTRLACILSFILFFARIAAVSINHLSKGSVYDGEFDEQKDISEINLAAGLDLFQGDIL
LQNSRNGLRDPSTRWKFPIPYILADNLALNAKGAILYAFEMFRLKSCVDFKPYEGESSYI
IFQEFSGCWSEVGDRHVGQNLSIGQGCDYKAIVEHEILHALGFYHEQSRTDRDDYVNIWW
DEILPGYQHNFNTYDDNFITDLNTPYDYESLMHYRPLSFNKNDSVPTITAKIPEFNSIIG
QRMDFSAIDLERLNRMYNCTTTHTFLDHCDFEKANICGMIQGTRDDTDWVHEDNTQPGQA
DHTLAGQCTGAGYFMYLNTSFGAAEEAAMLESRILYPKRKQQCLQFFYRMSGSPSDRLVV
WIRRDDSTGNVRKLVKVKTFQGDFDHNWKIAHVTFREEKKFRYLFQGTKGDPQNSSGGIY
LDDITLTETPCPTGVWTVRNFSQVLQNTVKGDKLQSPRFYNSEGYGLGLTLYPQGRTSSG
SSGYLGLTFHLCSGENDAVLEWPVENRQVIMTILDQEADVRKRMSSSMVFTTSKTQTSTA
INGSIIWDRPSVVGSYDNSCDCFRSIDWGWSAVISHQMLKRRSFLKNDDLIIFVDFEDIT
HLNQTEVQVQNSRLRPQGLVLHGQEQQTSEDSRKAPLETALPSSLDQGQSRRQKRSVDNT
GPLEDHNWPQYFRDPCDPNPCQNEGICVNVKGMVSCRCVSGQAFFYTGERCQAIQVHSSV
LGLLIGGVASVIFLTFTITSILYQTSRQ
Download sequence
Identical sequences W5PNK6
ENSOARP00000012032 XP_004019288.2.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]