SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012084 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012084
Domain Number 1 Region: 1483-1591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 784-899
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 241-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 4 Region: 621-725
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-32
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 5 Region: 1834-1943
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 6 Region: 2001-2121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-31
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 7 Region: 2172-2291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 65-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1303-1419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-28
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 10 Region: 444-554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 2360-2464
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 12 Region: 963-1072
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1136-1245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1651-1766
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-24
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 15 Region: 3067-3138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.44e-21
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 16 Region: 2712-2780
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.29e-19
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 17 Region: 2769-2837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2827-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 19 Region: 3008-3078
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 2951-3019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-17
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 2653-2722
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 3127-3196
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.23e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 23 Region: 381-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2526-2593
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 3186-3242
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 26 Region: 3247-3315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2883-2944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 28 Region: 2119-2188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000031
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 29 Region: 2464-2537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1947-2009
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 1423-1487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 32 Region: 905-965
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000783
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 559-618
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000136
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 34 Region: 1596-1661
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 35 Region: 1773-1839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 177-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000499
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 37 Region: 1078-1140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000836
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 38 Region: 1249-1311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000129
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 3306-3364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 40 Region: 730-797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 2600-2664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000499
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 42 Region: 2290-2353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000675
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012084   Gene: ENSOARG00000011267   Transcript: ENSOART00000012260
Sequence length 3603
Comment pep:known_by_projection chromosome:Oar_v3.1:9:63608850:65007715:1 gene:ENSOARG00000011267 transcript:ENSOART00000012260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGIRKGESRSKESKPREPGTRKCAKCGRLDFILMKKMGIKSGFTFRNLVFLLTVSCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQVKKAIDFKSRGFKLFPG
KDNSNKFSILNEGGIKTASNLCPDPGEPENGKRVGSDFSLGSTVQFSCDEDYVLQGAKSI
TCQRIAEVFAAWSDHRPVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTN
KVIQINFEEFDLEIGYDTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTD
ESVGSVGFKVNYKEIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVC
QENNQWSANIPICIFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFN
DFDLESQFDFLAIKDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNI
TYNTFGHNECPDPGIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMW
SGPIPRCGAPCGGHFSAPSGLILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTEL
NYDVLEVHDGPNLLSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVT
VNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHSLPTCD
ALCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLIT
ENGSFTQPLARLTGSELPSTVNAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCED
PGIPQYGNRIGFTFGVGDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGAS
ATNNEGILLSPNYPLNYENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTT
HLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGY
KISDQGHFAGSTIIYGCNPGYTLHGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSG
RILSPGYPFPYDNNLRCMWMIEVDPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKE
ISGSLIPEGIHSTLNVVTIQFDTDFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGR
EPGDTVIFQCDPGYELQGEERITCIQVENRYFWQPSPPVCIAPCGGNLTGSSGFILSPNF
PHPYPHSRDCDWTITVNADYVISLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLP
ERIESSSNNMHLAFRSDGSVSYTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVT
YYCDAGYILQGYSTLTCIMGDDGRPGWNRVLPSCHAPCGSRSTGSEGTVLSPNYPKNYSV
GHNCVYSIAVPKEFVVFGQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHSGESLPLSS
GNQITIRFTSVGPITAKGFHFVYQAVPRTSSTQCSSVPEPRFGRRIGNEFAVGSLVLFEC
NPGYILHGSIAIRCDTVPNSLAQWNDSLPTCIVPCGGILTKRKGTILSPGYPEPYDNNLN
CVWKITVPEGAGIQVQVVSFATEHNWDSLDFYDGGDNNAPRLGSYSGTTIPHLLNSTSNN
LYLNFQSDISVSAAGFHLEYTAIGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSL
QGHSHITCMPGPVRRWNYPIPICLAQCGGAMSDFSGVILSPGFPGNYPSSLDCTWTIKLP
IGFGVHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYFHSD
YSQNKQGFHIVYQAYQLQSCPDPRPFRNGFVIGNDFTVGQTISFECFPGYTLTGNSALTC
LHGVSRNWNHPLPRCEALCGGNITAMNGTIYSPGYPDEYPNFQDCFWLVKVSPGNGIYIN
FTVLQTEPIYDFITVWDGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFV
LSYHAYQLRVCQPPPPVPNAEILTEDDEFEIGDIIRYQCLPGFTLVGNAILTCRLGERLQ
MDGAPPVCQVLCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYNISMFVEFFQ
TEKEFDVLQVYDGPNIQSPVLVSLSGDYSSAFNITSNGHEVFLQWSADHGNNKKGFRIRY
IAFYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFRLVGKSSAVCRKSSYGYHAWDAPV
PACQAISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAICQSDGTWSNHN
KTPRCVVVTCPSINSFTLEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGT
WSWRNERPYCQIISCGELPTPPNGNKIGTQTSYGSTAIFTCDSGFMLVGSAVRECLSSGL
WSGSDTRCLAGHCGIPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWS
GQLPACVPVSCGHPGSPIYGRTSGNGFNFNDVVTFSCNIGYLMQGPTKAQCQANRQWSHP
PPVCKVVNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWD
KPLPECIMIDCGHPGVPPNAVLSGEKYTFGSTVHYSCTGKRTLLGQSSRTCQLNGHWSGS
QPHCSGDATGTCGDPGTPGHGSRQESDFRTKSSVRFACDTGYILHGSEERTCLPNGSWTG
RQPECKAVQCGNPGTTANGKVFRIDGTTFSSSVIYSCVEGYILSGPSVRQCTANGTWSGT
LPNCTIISCGDPGIPANGLRYGDDYVVGQNVSYMCQPGYTMEFNGSRIRTCTTNGTWSGV
MPTCRAVTCPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVP
QCLPKFCGDPGIPAQGKREGKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHC
IEPTRTSCDNPGVPRHGSQNNTFGFQVGSVVQFHCKKGHLLQGSTTRTCLPDLTWSGIQP
ECIPHSCKQPETPAHANVVGMDLPSHGYTLVYTCQPGFFLAGGTEHRVCRSDNTWTGKVP
VCEAGSKILVKDPRPALGTPSPKLSVPDDVFAQNYIWKGSYNYKGRKQPMTLTVTSFNAS
TGRVNATLSNSNMELLLSGVYKSQEARLMLHIYLIKVPAQATVKKMKEENWAMDGFVSAE
PDGATYVFQGFIQGKDYGQFGLQRLGLNMSEGSNSSNQPHGTNSSSVAIAILVPFFALIF
AGFGFYLYKQRTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVC
TMV
Download sequence
Identical sequences W5PNQ8
XP_012039341.1.66739 ENSOARP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]