SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012096 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012096
Domain Number 1 Region: 922-1030
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 231-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 3 Region: 68-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 4 Region: 1203-1312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 5 Region: 1370-1490
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 6 Region: 1541-1660
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-30
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 7 Region: 740-856
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 8 Region: 410-519
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 573-682
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 10 Region: 1729-1834
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-24
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2437-2508
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.69e-21
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 12 Region: 2082-2150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.94e-19
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 13 Region: 2139-2207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.43e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 14 Region: 2197-2270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-18
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 15 Region: 2378-2448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.95e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2321-2389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 17 Region: 2023-2092
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-17
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 18 Region: 2497-2566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.61e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 1896-1963
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 2556-2612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 21 Region: 2617-2685
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2253-2314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 23 Region: 1488-1557
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 24 Region: 1834-1907
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1316-1378
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000031
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 860-925
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000594
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 352-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000634
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 28 Region: 6-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000011
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 29 Region: 1035-1100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000112
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 1142-1208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 31 Region: 686-748
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000104
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 2676-2734
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 33 Region: 177-244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 1970-2034
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000405
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 35 Region: 1659-1722
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000553
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 36 Region: 1096-1135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000131
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 37 Region: 525-577
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000607
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012096   Gene: ENSOARG00000011267   Transcript: ENSOART00000012272
Sequence length 2973
Comment pep:known_by_projection chromosome:Oar_v3.1:9:64508291:65007715:1 gene:ENSOARG00000011267 transcript:ENSOART00000012272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPIC
IFPCLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAI
KDGDSPDSPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDP
GIPINARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGPIPRCGAPCGG
HFSAPSGLILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNL
LSPLLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPV
HGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHSLPTCDALCGGDVRGPSGT
ILSPGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLT
GSELPSTVNAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGNRIGFT
FGVGDTLTFSCSSGYLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLNYENNHEC
IYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTLSSTSNQL
WLEFNSDSEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYGCNPGYTL
HGSSLLKCMTGERRAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNNLRCMWMIEV
DPGNIVSLQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNVVTIQFDT
DFYISKSGFAIQFSSSVATACRDPGVPMNGTRNGDGREPGDTVIFQCDPGYELQGEERIT
CIQVENRYFWQPSPPVCIVKAPCGGNLTGSSGFILSPNFPHPYPHSRDCDWTITVNADYV
ISLAFISFSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNNMHLAFRSDGSVS
YTGFHLEYKAKLRESCFDPGNIMNGTRLGMDYKLGSTVTYYCDAGYILQGYSTLTCIMGD
DGRPGWNRVLPSCHAPCGSRSTGSEGTVLSPNYPKNYSVGHNCVYSIAVPKEFAVPRTSS
TQCSSVPEPRFGRRIGNEFAVGSLVLFECNPGYILHGSIAIRCDTVPNSLAQWNDSLPTC
IVPCGGILTKRKGTILSPGYPEPYDNNLNCVWKITVPEGAGIQVQVVSFATEHNWDSLDF
YDGGDNNAPRLGSYSGTTIPHLLNSTSNNLYLNFQSDISVSAAGFHLEYTAIGLDSCPEP
QTPSSGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRWNYPIPICLAQCGGAM
SDFSGVILSPGFPGNYPSSLDCTWTIKLPIGFGVHLQFVNFSTETIHDYLEVRSGSSETS
TVIGRLSGPQIPSSLFSTTHETSLYFHSDYSQNKQGFHIVYQAYQLQSCPDPRPFRNGFV
IGNDFTVGQTISFECFPGYTLTGNSALTCLHGVSRNWNHPLPRCEALCGGNITAMNGTIY
SPGYPDEYPNFQDCFWLVKVSPGNGIYINFTVLQTEPIYDFITVWDGPDQNSPQIGQFSG
NTALESVYSTSNQILIKFHSDFTTSGFFVLSYHAYQLRVCQPPPPVPNAEILTEDDEFEI
GDIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQVLCPANELRLDSTGVILSPGYP
DSYPNLQMCAWSISVEKGYNISMFVEFFQTEKEFDVLQVYDEGPNIQSPVLVSLSGDYSS
AFNITSNGHEVFLQWSADHGNNKKGFRIRYIAFYCSTPESPPHGYIISQTGGQLNSVVRW
ACDRGFRLVGKSSAVCRKSSYGYHAWDAPVPACQAISCGIPKAPTNGGILTTDYLVGTRV
TYFCNDGYRLSSKELTTAICQSDGTWSNHNKTPRCVVVTCPSINSFTLEHGRWRIVNGSH
YEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQIISCGELPTPPNGNKIGTQ
TSYGSTAIFTCDSGFMLVGSAVRECLSSGLWSGSDTRCLAGHCGIPELIVNGQVIGENYG
YRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPACVPVSCGHPGSPIYGRTSGNGFNFN
DVVTFSCNIGYLMQGPTKAQCQANRQWSHPPPVCKVVNCSDPGIPANSKRESKIEHGNFT
YGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECIMIDCGHPGVPPNAVLSGEKYTFG
STVHYSCTGKRTLLGQSSRTCQLNGHWSGSQPHCSGDATGTCGDPGTPGHGSRQESDFRT
KSSVRFACDTGYILHGSEERTCLPNGSWTGRQPECKAVQCGNPGTTANGKVFRIDGTTFS
SSVIYSCVEGYILSGPSVRQCTANGTWSGTLPNCTIISCGDPGIPANGLRYGDDYVVGQN
VSYMCQPGYTMEFNGSRIRTCTTNGTWSGVMPTCRAVTCPTPPQISNGRLEGTNFDWGFS
ISYICSPGYELSFPAVLTCVGNGTWSGEVPQCLPKFCGDPGIPAQGKREGKSFIYQSEVS
FSCNSPFILVGSSTRICQADGTWSGSSPHCIEPTRTSCDNPGVPRHGSQNNTFGFQVGSV
VQFHCKKGHLLQGSTTRTCLPDLTWSGIQPECIPHSCKQPETPAHANVVGMDLPSHGYTL
VYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCEAGSKILVKDPRPALGTPSPKLSVPDDV
FAQNYIWKGSYNYKGRKQPMTLTVTSFNASTGRVNATLSNSNMELLLSGVYKSQEARLML
HIYLIKVPAQATVKKMKEENWAMDGFVSAEPDGATYVFQGFIQGKDYGQFGLQRLGLNMS
EGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFYLYKQRTAPKTQYTGCSVHENNNGQ
AAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
Download sequence
Identical sequences W5PNS0
ENSOARP00000012096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]