SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012130 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012130
Domain Number 1 Region: 62-190
Classification Level Classification E-value
Superfamily TIMP-like 5.81e-24
Family Tissue inhibitor of metalloproteinases, TIMP 0.087
Further Details:      
 
Domain Number 2 Region: 13-47
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000111
Family Frizzled cysteine-rich domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012130   Gene: ENSOARG00000011322   Transcript: ENSOART00000012306
Sequence length 200
Comment pep:known_by_projection chromosome:Oar_v3.1:22:18137028:18141557:-1 gene:ENSOARG00000011322 transcript:ENSOART00000012306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPEASCRERGEPSVRAGCAQLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPV
TKICAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKR
KDTKRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKF
MFSYPCSLYYPFFYGAAEPH
Download sequence
Identical sequences W5PNV4
ENSOARP00000012130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]