SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012244 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012244
Domain Number 1 Region: 235-435
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.53e-45
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 450-526
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 6.42e-19
Family Blood coagulation inhibitor (disintegrin) 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012244
Domain Number - Region: 674-713
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family Integrin beta EGF-like domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012244   Gene: ENSOARG00000011416   Transcript: ENSOART00000012420
Sequence length 903
Comment pep:known_by_projection chromosome:Oar_v3.1:4:72069800:72301436:1 gene:ENSOARG00000011416 transcript:ENSOART00000012420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDECPSGSLFSPFLPNSSFPSFLPEGDASLTELERRNENRFLERQSIVPLRLIYSSGGED
ETGHDALDTRVRGDPSSGQLTHVDQASFQLDAFGTSFILDVLLNHDLLSSEYVERHIEHG
GKTVEVKGGEHCYYQGHIRGNPASFVALSTCHGLHGMFYDGNHTYLIEPEGNDTSQEDFH
VHSVYKSRLFEFPLDDLPSEFQQVNITPPKFILKPRPKRSKRQLRRYPRNVEEEIKYIEL
MIVNDHLMFKKHRLSVVLTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWAADNKFAISE
NPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKT
DLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYH
DFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDS
QCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICF
GGRCKTRDRQCKYIWGQNVMSSDKYCYEKLNIEGTEKGNCGRDKDTWIQCNKRDVLCGYL
LCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLDEDVDLGYVEDGTPCGPKMMC
LEHRCLPVASFNFSTCLSNKEGTICSGNGVCSNELKCVCNRHWVGEDCSTYFPYNDDAKA
GITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGDGDS
FYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNR
KKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEEKKVNRQSARLWE
TSI
Download sequence
Identical sequences W5PP68
ENSOARP00000012244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]