SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012272 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012272
Domain Number 1 Region: 108-169,417-556
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-19
Family Pectate lyase-like 0.043
Further Details:      
 
Domain Number 2 Region: 724-889
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.01e-17
Family Pectate transeliminase 0.061
Further Details:      
 
Domain Number 3 Region: 6-79
Classification Level Classification E-value
Superfamily F-box domain 2.62e-16
Family F-box domain 0.004
Further Details:      
 
Domain Number 4 Region: 530-673
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.07e-16
Family Galacturonase 0.072
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012272
Domain Number - Region: 125-258,287-317
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00216
Family Pectin methylesterase 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012272   Gene: ENSOARG00000011447   Transcript: ENSOART00000012448
Sequence length 950
Comment pep:known_by_projection chromosome:Oar_v3.1:2:50886953:50925801:1 gene:ENSOARG00000011447 transcript:ENSOART00000012448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGGLPLELWRMILAYLPLPDLGRCSLVCRAWHELILSLDRTRWRQLYLGCAECRHPNW
PNQPDVEPESWREAFKQHYLASKTWTKNAAILETSVCFSLFRRRRTRRTLSVGPGHEFHS
LGSALAMSSLFDRILLFPGLHEEQGEIILKVPVEIVGHGKLGEVALLASIDQQCSTTRLC
NLVFMPAWFSPFMFKTTSGHVQFDNCNFENGHIQVHGPGTCQVKFCSFKNTHVFLHNVPL
CVLENCEFVGSENNSVTVEGHPSSENNWAYTHLLGLIRSSPGVLPTEDSDSLMSLDLESR
DQAWSPRTCGIVIEGSQSPTSLATGSPTAGSQEAEVGSNGERVARTPDSSDGGLSPSGED
EDEDQLTYRLSYQVQGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLQQELQKDREAMALA
SSVQGCLIRKCLFRDGKGGVFVCSYGRAKMEGNIFRNLTYAVRCIHNSKIIMLRNHIHHC
RASGIFLRLEGGGLIAGNNICHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGI
IRNNQIFSNKEAGIYILYHGNPVVSRNHIFKGHAAGIAVNENGRGLITENVIRENQWGGV
DIRRGGVPILRSNLICFGYSDGVVVGDEGKGLLEGNTIYANKGCGVWMMASSLPHVTSNH
VSYNGLYGVAVFSQKDGSGEFPGGHGGQENFSEDGDAILWETELEKDDDPLRRPITVALV
ESNSVNHNGASGLYIQSSEALHIVNNVIHANRVRGITVAQSSQLTRVANNSISCNRQSGV
KIEAQCKVELRGNGIYDNRGHGIITKGDSTVMENDIIGNRGSGLQLLPMSDTKVIKNRIH
SFRASGIAVQGHAKALVQDNTIFQGRTNKTIFQQSSNNQECIIQNNRFLVFKKSDTWRLT
NPPARPHLENSLRGPSAAHGGQKVTAMATRITAHVEGGYHSKRSIFCTIL
Download sequence
Identical sequences W5PP96
ENSOARP00000012272 XP_014948624.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]