SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012696 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012696
Domain Number 1 Region: 377-456
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000249
Family F-box domain 0.0045
Further Details:      
 
Domain Number 2 Region: 471-645
Classification Level Classification E-value
Superfamily RNI-like 0.000000216
Family Cyclin A/CDK2-associated p19, Skp2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012696
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0819
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012696   Gene: ENSOARG00000011843   Transcript: ENSOART00000012882
Sequence length 694
Comment pep:known_by_projection chromosome:Oar_v3.1:3:95210325:95219586:-1 gene:ENSOARG00000011843 transcript:ENSOART00000012882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAFPLAPR
ARLKIRALEKLEVDRRLERARLGREKEELEERASELSRQVDVSVELLASLKQDLVHKEQE
LSRKQQEVVQIDQFLKETAAREASAKLRLQQFIEELLQRADRAERQLQPSGFTSGAGVGG
GGGGAGAGPSTRAPGRTREHHAGPAMPSTYAVSRHGSSPSTGASSRIPAASQSSGCYDSD
SLELPRPEEGAPEDSGPGGLGTRVQAAGGGWERGQPPRSSGLRRQAIQNWQRRPRRHSTE
GEEGDVSDVGSRTTESEAEGPSDVPRPGPAMAGPVSSCRLSARPEGGSGRGRRAERGSPS
RSNEVISPEILKMRAALFCIFTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVC
SKFLAMLAQWCTQAHSLTLQNLKPRQRGKKESKEEYARSTRGCLEAGLESLLKAAGGNLL
ILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGHEVIWALGAGCREIVSLQVAP
LHPCQQPMRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRLQVLELDHVSE
ITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS
PEAQKLFEDMITKLQALRRRPGFSKILHIKVEGC
Download sequence
Identical sequences W5PQG9
ENSOARP00000012696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]