SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012730 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012730
Domain Number 1 Region: 312-718
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.96e-111
Family Phosphofructokinase 0.0000101
Further Details:      
 
Domain Number 2 Region: 1-321
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.53e-98
Family Phosphofructokinase 0.00000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012730   Gene: ENSOARG00000011864   Transcript: ENSOART00000012917
Sequence length 752
Comment pep:known_by_projection chromosome:Oar_v3.1:1:262409923:262432838:1 gene:ENSOARG00000011864 transcript:ENSOART00000012917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIRQANWLSVSNIIQLGGTVIGSAR
CKAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGSLLEELVSEGKISEG
TAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVM
GRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAID
RNGKSISSRYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEAT
PDTPACVVSLSGNQSVRLPLMECVQLTKEVQKAMDEKRFDEAIQLRGRSFENNWNIYKLL
AHQKISKEKTNFSLAILNVGAPAAGMNAAVRSAVRSGISQGHTVYVVHDGFEGLAKNQVQ
EVSWHDVAGWLGRGGSMLGTKRTLPKGYMEQIVESIRLHNIHALLVIGGFEAYEGVLQLV
EARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGTKRRVFI
VETMGGYCGYLATVTGIAVGADAAYVFEDPFNIQDLKANVEHMTEKMKTEIQRGLVLRNE
KCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAILWMSE
KLRAVYRNGRVFANAPDSACVIGLQKKVVAFSPVTELKKDTDFEHRMPREQWWLNLRLML
KMLAHYRISMADYVSGELEHVTRRTLSIETGF
Download sequence
Identical sequences W5PQK3
ENSOARP00000012730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]