SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012805 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012805
Domain Number 1 Region: 328-605
Classification Level Classification E-value
Superfamily RNI-like 5.3e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.0053
Further Details:      
 
Domain Number 2 Region: 266-334
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000301
Family F-box domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012805   Gene: ENSOARG00000011946   Transcript: ENSOART00000012992
Sequence length 621
Comment pep:known_by_projection chromosome:Oar_v3.1:8:37900554:37974589:1 gene:ENSOARG00000011946 transcript:ENSOART00000012992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVFPMLTVLTMFYYMCLRRRARTATRGEIMNSHRTVESNSRTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSAPVPFKRTPAN
FQSQDYVELAFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPGPPAEVRWETLWSEKP
TKVNASQARQFKPCIKQINFPTNLIRLEINSSLLDYYTELDAVVLHGMKDKPMLSLKTSL
IDMNDLEDDDYEEKDDCEIDNLNKKFSSTALREGPSNGYFDRLPYELIQLILNHLTLPDL
CRLAQTCKLLNQHCCDPLQYIHLNLQPYWAKLNDTSLEFLQARCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEIISEMCPNLQDLNLSSCDKLPPQAFS
HIAKLCGLKRLVLYRTKVEQTALLSILNFCSDLQHLSLGSCVMIEDYDVTASMIGAKCKK
LRTLDLWRCKNITESGIAELASGCPLLEELDLGWCPTLQSSTGCFARLARQLPNLQKLFL
TANRSVCDTDIEELACNCTRLRQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELSASFPKVFIKKSFTQ
Download sequence
Identical sequences W5PQS8
ENSOARP00000012805 XP_004011306.1.66739 XP_011996338.1.54773 XP_011996339.1.54773 XP_012038124.1.66739 XP_017908624.1.57651 XP_017908625.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]