SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012844 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012844
Domain Number 1 Region: 159-448
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.06e-42
Family WD40-repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 60-127
Classification Level Classification E-value
Superfamily F-box domain 0.000000000103
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012844   Gene: ENSOARG00000011977   Transcript: ENSOART00000013031
Sequence length 450
Comment pep:known_by_projection chromosome:Oar_v3.1:5:10886065:10890531:1 gene:ENSOARG00000011977 transcript:ENSOART00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPPGPRDDPHTWDDDSDPELEPDPDAQAEAYVARVLSPPKLGLAPPRAPPLPAPPRAA
SKGSTVAVPGLLSLPPELLLEICAYLDARLVLHVLPRVCHALRDLVRDRVTWRLRAQRRV
RSPNPVQGVEDFDWPTACIELEQHLSRWAEDGRRAEYFCLADGHFASIDSVLLLQGGTLC
LSGSRDRNVNLWDLQQLGVEPSRVLVKTLGTQKNSTHKGWVWSLAALDHRVCSGSWDSTV
KLWDMAADGQQFGEIKGKAAVLCLSYRPDILVTGTYDKKVTVYDPRVGPALLKSRRLHSS
AVLALLADDRHIISGSEDHTLVVFDRRANSVLQRLQLDSYLLCMSYQEPQLWAGDNQGLL
HVFANRSGCFQLVRSFDVGHRSQITGIKHSLGTLYTTSTDKTIRVHVPTDPPRTICTRSH
HNVLNGICAEGNLVVAASGGLSLEVWRLQA
Download sequence
Identical sequences W5PQW6
ENSOARP00000012844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]