SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012864 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012864
Domain Number 1 Region: 41-252
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.64e-57
Family Reprolysin-like 0.0004
Further Details:      
 
Domain Number 2 Region: 339-394
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000719
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 1283-1345
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 742-794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000405
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1122-1173
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 6 Region: 624-680
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 676-738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000012864
Domain Number - Region: 1236-1286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0301
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012864   Gene: ENSOARG00000011993   Transcript: ENSOART00000013051
Sequence length 1408
Comment pep:known_by_projection chromosome:Oar_v3.1:16:39935100:40186430:1 gene:ENSOARG00000011993 transcript:ENSOART00000013051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPACGLKDSPGTSQKQELLREKWERSHLRGRSLSRRSISKERWVETLVVADTKMIEYH
GRENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLILLEEEEQGLKIVHHAEKTLSSFC
KWQKSINPKSDLNPAHHDVAVLLTRKDLCAGVNHRCETLGLSHLSGMCQPHRSCNINEDS
GLPLAFTVAHELGHSFGIQHDGKENDCEPVGRHLYIMSRQLQYNPAPLTWSKCSKDYITR
FLDRGWGFCLDDIPQKKGLKSKIIAPGVIYDVHHQCQLQYGPNATFCQEVENVCQTLWCS
VKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPESIPGGWGRWSPWSHCSRTCGAGA
QSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRPDTPTFRQMQCSEFDTVPYRNEFYH
WFPVFNPARPCELYCRPIDGHFSEKMLDAVIDGTPCFEGGNSRNVCINGMCKMVGCDYEI
DSTATEDRCGVCLGDGSACQTVKKMFKQKEGSGYVDIGLIPKGARDIRVMEVEGAGNFLA
IRSEDPEKYYLNGGFIIQWNGNYKLAGTIFQYDRKGDLEKLMATGPTNESVWIQLLFQVT
NPGIKYEYTIRKDGLDNDVEKLVYFWQYGRWTECSVTCGTGIRRQTAHCVKKGRGIVKAT
FCDPETQPNGRQKKCHEKDCPPRWWAGEWEACSATCGPHGEKKRTVLCIQTMGSDEQALP
PQDCQHLLKPKTLVSCNRDILCPSDWTVGNWSECSVSCGGGVRIRSVTCAKNHDEPCDMT
RKPNSRALCGLQQCPSSRRILKPNRGTIFSGKNLLTPDPLKPVPPTTPSPRMLTTPSPGV
LTTPTVPGPLSTSTPTINIPDPTIASKGGDLDGKQGQNSSIQTELDTHNVISTGSTSQPI
LTSWSLSIQPNEENVSNPNTGPTSEGDLVITTTSGSDLSTSSNAVTWQVTSFYSPLTKEP
EMEIHSGSGEGSESSEKKNENNSVTWTKIRVPGNDATGERSIEIPLGPPPTPYLGGTSLW
PPFSTVSEGLVPSQRPITLKNGASRAEGTVTEKPANTPLPLDHQPSYSKKPVNPHSSELP
SNMNITQSSGPVLTKEDATSLMAEGFLLNASDYKQLSMGHSPAYWIVGNWSECSTTCGLG
TYWRSVQCSTQVDSDCAALQRPDPAKRCHLRPCAGWKVGNWSKISRVCCRSPTWKMCQDG
SIDQKRHNRILRVFHCPFLEITWPGSPVSVCAHTAGCGPWQSRAWGSHQCSSSCGGGVQK
RGVTCPGLCDWTKRPTATAPCSGQPCCHWAAGNWDPCTVSCGGGFQKRTVHCVASENNKT
EGQDQCLCDHDPRPPEFQKCNPQACRKNADLLCTKDNLSASFCQTLKTMKKCSVPTVRAQ
CCLSCSQTHVAHTQRPRKRQPLKNPKAP
Download sequence
Identical sequences W5PQY6
ENSOARP00000012864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]