SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000012959 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000012959
Domain Number 1 Region: 322-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.79e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 145-321
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.53e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000793
Further Details:      
 
Domain Number 3 Region: 606-712
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.27e-28
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 83-143
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000109
Family TGS domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000012959   Gene: ENSOARG00000012085   Transcript: ENSOART00000013148
Sequence length 723
Comment pep:known_by_projection chromosome:Oar_v3.1:16:40229272:40250506:-1 gene:ENSOARG00000012085 transcript:ENSOART00000013148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEQASSPSAKMGDEENPVGAGEEKQKEGSKKKNKEGSGDGGRAELNPWPEYINTRLEL
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNKAVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKSDMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWVTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAIEQIEDEIKGCL
DFLRTVYSIFGFSFKLNLSTRPEKFLGDVEVWDQAEKQLENSLNEFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVQQQFHDAKFMVDIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKTGGTVNIRTRDNKVHGERTISETIERLQQLKRSRSKQAE
EEF
Download sequence
Identical sequences W5PR81
XP_004017114.1.66739 XP_012020087.1.54773 ENSOARP00000012959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]