SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013043 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013043
Domain Number 1 Region: 350-460
Classification Level Classification E-value
Superfamily TIMP-like 3.77e-19
Family Tissue inhibitor of metalloproteinases, TIMP 0.012
Further Details:      
 
Domain Number 2 Region: 42-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013043   Gene: ENSOARG00000012165   Transcript: ENSOART00000013232
Sequence length 469
Comment pep:known_by_projection chromosome:Oar_v3.1:5:41305157:41311154:-1 gene:ENSOARG00000012165 transcript:ENSOART00000013232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGKLRPGGVAALRLYPPCGFSDLLLLLWTFLNCGLGGNTQGPGEWTPWGSWSRCSSSCGR
GLSVRSRRCIRFPREELCWGNTHEYRLCQQPDCPPAAMPFRDLQCALYNGHPVLGTQKTY
QWVPFYGAPNQCDLNCLAVGHDFYHSFGRVLDGTPCSPGAQGLCVAGRCLSAGCDGLLGS
DAREDRCGRCGTQCLFVQRVFRDAGAFAGYWNVTLIPEGARHIRAAHRSRNHLALMGGDG
RYVLNGNWVVSPAGTYEAAGTRVVYTRATGPEETLRAAGPTSEDLLLQVLLQEPNPGIEF
EFWLPRERYGPFQAQAQVLGWSPRQPQPREVEPQPLESPTVIPPRTPIPTPEPCPPCPDT
RGRAHRLLHYCGSDFVFRARVLGRIRQAQETRYEVRVQLIYKNRSPLRALEYVWAPSHCP
CPPLALHRDYLLAARRLISPDGTQDRLLLPAWSPAEDSRVRLAARHCPL
Download sequence
Identical sequences W5PRG4
ENSOARP00000013043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]